SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330692|ref|NP_441420.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330692|ref|NP_441420.1|
Domain Number 1 Region: 6-186
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.33e-37
Family Phosphoglucomutase, first 3 domains 0.0017
Further Details:      
 
Domain Number 2 Region: 257-384
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.08e-27
Family Phosphoglucomutase, first 3 domains 0.0023
Further Details:      
 
Domain Number 3 Region: 161-271
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.92e-23
Family Phosphoglucomutase, first 3 domains 0.0031
Further Details:      
 
Domain Number 4 Region: 390-477
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 3.79e-20
Family Phosphoglucomutase, C-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330692|ref|NP_441420.1|
Sequence length 490
Comment hypothetical protein slr1334 [Synechocystis sp. PCC 6803]
Sequence
MVYTPAPIKFGTDGWRGVIAAEFTFERVVLVAAAAAQVLAAEFGSSGREHRLIVGYDRRF
MAEQFALLVAQTVQELGFEVWLSESYAPTPAFSWAAHHENALGALVLTASHNPANYLGLK
VKGAFGGSVGSDVTEKIEAQLQNSLPQPQAGGSLQYFDPWPSYCQGLQAKVNVQPIREAV
QQGKLRVFADVMHGAAASGLERLLGCPIDEINGDRDPLFGGASPEPLPKYVPKLLAALQT
AAKAGGPELRVGLIFDGDADRIAAVDGQGNFLSSQGLIPILIYHLATQKGLQGEIVKTVS
GSDLIPKLAELYGIPLTETAIGYKYIADRMLTSPVLIGGEESGGIGYGGHIPERDALLSA
LYVLETVVQSQQDISEQYGRLQEKVCFVSEYDRIDLPLASMDVRTALVQTLNENPLTAIA
GEQVTDLLTTDGYKFRMAGGGWLLIRFSGTEPLLRLYCEAPTSSRVQTVLHWAKDWANGV
TPAKPAQSSH
Download sequence
Identical sequences L8AK65 P74027
WP_010872725.1.11876 WP_010872725.1.1889 WP_010872725.1.18904 WP_010872725.1.33690 WP_010872725.1.35395 WP_010872725.1.47586 WP_010872725.1.99424 gi|383322434|ref|YP_005383287.1| gi|16330692|ref|NP_441420.1| gi|16330692|ref|NP_441420.1| 1148.slr1334 gi|383491487|ref|YP_005409163.1| gi|383325603|ref|YP_005386456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]