SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330702|ref|NP_441430.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330702|ref|NP_441430.1|
Domain Number 1 Region: 13-102
Classification Level Classification E-value
Superfamily Translation proteins 3.53e-18
Family RimM N-terminal domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 111-183
Classification Level Classification E-value
Superfamily PRC-barrel domain 0.0000000000255
Family RimM C-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330702|ref|NP_441430.1|
Sequence length 185
Comment 16S rRNA-processing protein RimM [Synechocystis sp. PCC 6803]
Sequence
MAEPMTEQQKTENWLEIGTIVAAQGIQGEVRVLSASDFPARFLTKGQRWIRKTPQETPQP
LTLKKGKQIPGKNLYILRFTEITDRNQAEALVNYQLLVPATDRLPLEPGEFHVTDLLGLI
VYDHDNGDRLGIVTDFYSAGNDLLGITLDKNPDKEVLVPFVEAIVPTVELAEQRLEIKTI
PGLLD
Download sequence
Identical sequences L8AK72 P74035
gi|383325613|ref|YP_005386466.1| gi|16330702|ref|NP_441430.1| SdR20 gi|16330702|ref|NP_441430.1| 1148.slr0808 gi|383491497|ref|YP_005409173.1| WP_010872735.1.11876 WP_010872735.1.1889 WP_010872735.1.18904 WP_010872735.1.33690 WP_010872735.1.35395 WP_010872735.1.47586 WP_010872735.1.99424 gi|383322444|ref|YP_005383297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]