SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330721|ref|NP_441449.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330721|ref|NP_441449.1|
Domain Number 1 Region: 38-473
Classification Level Classification E-value
Superfamily ADC synthase 1.83e-90
Family ADC synthase 0.00000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330721|ref|NP_441449.1|
Sequence length 474
Comment menaquinone-specific isochorismate synthase [Synechocystis sp. PCC 6803]
Sequence
MSVATPLLDRHPCSLDNSSVLHGYLVEQQRGLASGQRFLWSFTENLGKVDPLAVFGALNV
QDKVHFYGENPQRGETILAFGICQSLRISGKYRFSLAQQFAEECFQRLVPIGNVQGRSQR
PYIFCGFSFFDRPSNRNPFANSFLFLPQIQVVKTSQHCLLSWQISLDGNTNVTDLVDFIG
RMLSAIRRAQPARDTHTPSMVVKAPRLTGIEVAKLSKAIASSLEEIAQQRLSKVVLATAL
DLDYGSRLNVAHCLQRLRQQYGDCYLFSWGNGQGDCFVGASPERLLSLHNQQLVTDALAG
SAPRDVDVQGDRQLGQELLHNPKELREHQAVLDYLLQRLRALGLSPQASSLKLLKLANIQ
HLWTQIQAPLPPHIHPLALVQQLHPTPAVAGVPVAIAEDLIRRHETFDRNLYAAPLGWLD
SEGNAEFIVGIRSALLSRNRARLYAGAGIVAGSDPLKEVAEIELKLQTLWRSLI
Download sequence
Identical sequences P74053
WP_010872754.1.11876 WP_010872754.1.1889 WP_010872754.1.18904 WP_010872754.1.33690 WP_010872754.1.35395 WP_010872754.1.47586 WP_010872754.1.99424 gi|383491516|ref|YP_005409192.1| gi|383322463|ref|YP_005383316.1| gi|383325632|ref|YP_005386485.1| gi|16330721|ref|NP_441449.1| 1148.slr0817 gi|16330721|ref|NP_441449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]