SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330751|ref|NP_441479.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330751|ref|NP_441479.1|
Domain Number 1 Region: 3-311
Classification Level Classification E-value
Superfamily DHH phosphoesterases 9.29e-44
Family Manganese-dependent inorganic pyrophosphatase (family II) 0.0093
Further Details:      
 
Domain Number 2 Region: 662-936
Classification Level Classification E-value
Superfamily Poly A polymerase C-terminal region-like 7.59e-42
Family Poly A polymerase C-terminal region-like 0.0014
Further Details:      
 
Domain Number 3 Region: 329-453
Classification Level Classification E-value
Superfamily CBS-domain pair 8.21e-35
Family CBS-domain pair 0.0008
Further Details:      
 
Domain Number 4 Region: 486-659
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.51e-28
Family Poly A polymerase head domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330751|ref|NP_441479.1|
Sequence length 942
Comment poly(A) polymerase [Synechocystis sp. PCC 6803]
Sequence
MDLILCHQTADFDVLGAAVGLAKLHPGSRIVLTGGSHPTVRQFLALHRNEFPLIELRSVN
PDKIRSLYIVDNQQGDRLGKAADWLTLPHLRQVAIYDHHLNSPRDIEADIWELEAVGAST
TLIVEKLQRADISLSMVEASVMALGIHVDTGSLTFTQTTVRDVKALAWLMEQGANLRLIA
EYADPGFPPPLQFLFAEAMQNLHKEMVRGYWLGSVLLTTENFVPGLSHLTERLLSLTECD
ALLLGHVYDKGKDKTKNDEQREKTGVISNQRFSLIGRTRIPDTDLTQLLEPYGGGGHAQA
AAVNLRDVEPTTVMAEIYQALQRQIPKPLLARDFMSSPVRTIRPHTTIEQAQRVLFRYGH
SGLTVVNQEEKLVGIISRRDLDLALHHGFSHAPVKGYMTRNVKTIAPDTPLPRIEAIMVA
DDVGRLPVMDQEKLVGIVTRTDVLRQLLQDKQEQSGRFGAPRSGSLRDRPTTPNQNFGQG
SLLQLLKTHLPPATWQLLTTAAQQAQTRGWHLYLVGGAVRDLWLRHSQGAEKHQNITFQD
IDLVVDGFHATADVGAGVELAQALQGDYPGARLSVHGEFQTAALLWHKDPQLDTLWVDIA
TARTEFYPYPAANPEVEASSIRQDLYRRDFTINALSIRLTNPNPGKLLDFFGGMNDLQSQ
QVRVLHANSFIEDPTRIYRAVRFVVRLGFELEPQTETYIRYAIASGVYERWRLTEHPTPA
LTTRLKAELSIILKAPYWKGALTLLADLDALKCLHAELKLTEQLWWQVRYLSRWLRWFDP
ERNLEHWLLRLGILLGALPPQEREKIAAGLQLPKATIDGLTNLETIETAIAKGLNSPASP
KSSPKSSVIYQTLKDYDRFSLFLVAARGNKLLRKQIWFYFSQLCQVSPFLTGHDLKALGY
KPGPQFKQILTDLLNACLDGELGDRQQEEAWLRTHYPLPNKV
Download sequence
Identical sequences L8AK18 P74081
gi|383325662|ref|YP_005386515.1| gi|16330751|ref|NP_441479.1| gi|383322493|ref|YP_005383346.1| 1148.sll1253 WP_010872782.1.11876 WP_010872782.1.1889 WP_010872782.1.18904 WP_010872782.1.33690 WP_010872782.1.35395 WP_010872782.1.47586 WP_010872782.1.99424 gi|383491546|ref|YP_005409222.1| gi|16330751|ref|NP_441479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]