SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330767|ref|NP_441495.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330767|ref|NP_441495.1|
Domain Number 1 Region: 159-365
Classification Level Classification E-value
Superfamily Radical SAM enzymes 7.19e-27
Family Biotin synthase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330767|ref|NP_441495.1|
Sequence length 536
Comment hypothetical protein sll1242 [Synechocystis sp. PCC 6803]
Sequence
MRALLIYPLFPPTFWSYEKILELVGRKVLLPPLGLITVAGILPQEWEFKLVDRNVRNVTE
AEWDWAEVVIISGMIVQRDDMVENIKEAKAHGKLVAVGGPFATSVPDEVQNAGADFLILD
EGEITLPLFVEALERGETAGIIRAQEKPDVTTTPIPRYDLLELDAYDSMSVQFSRGCPFQ
CEFCDIIVLYGRKPRTKEPAQLLRELDYLYELGWRRSVFMVDDNFIGNKRNVKLLLKELK
VWQEEHQYPFRFNTEASVDLADDQELMDLMVECYFDAVFLGIETPDEESLEFTKKFQNTR
NSLADSVDKIIKAGLRPMAGFIIGFDGEKQGAGDRIVRFAEQTAIPTTTFAMLQALPNTA
LWHRLKRENRLLDESKGNINQTTLMNFIPTRPLEDIANEYVEAFWELYDPHGYLDRNYRC
FLKLGAPKCKTAFKLPNLVDLKALAIVIWRQGVKRDTRFRFWHHAFGILRHNPAVFEHYI
TLCAHNEHFLQYREIVRQEIGEQLRDYLSRQQQDKVEETVLSPTAIAAETEKVLAS
Download sequence
Identical sequences L8AKH5 P42349
gi|383491562|ref|YP_005409238.1| gi|383325678|ref|YP_005386531.1| 1148.sll1242 gi|383322509|ref|YP_005383362.1| gi|16330767|ref|NP_441495.1| gi|16330767|ref|NP_441495.1| WP_010872798.1.11876 WP_010872798.1.1889 WP_010872798.1.18904 WP_010872798.1.33690 WP_010872798.1.35395 WP_010872798.1.47586 WP_010872798.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]