SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330810|ref|NP_441538.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330810|ref|NP_441538.1|
Domain Number 1 Region: 10-453
Classification Level Classification E-value
Superfamily Radical SAM enzymes 1.7e-131
Family Oxygen-independent coproporphyrinogen III oxidase HemN 0.00000000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330810|ref|NP_441538.1|
Sequence length 466
Comment coproporphyrinogen III oxidase [Synechocystis sp. PCC 6803]
Sequence
MTTTFPTVEFSAELLNKYNQGIPRYTSYPPATELNKEFDPSDFQTAINLGNYKKTPLSLY
CHIPFCAKACYFCGCNTIITQHKPAVDPYLKAVAKQIALVAPLVDQQRPVQQLHWGGGTP
NYLTLEQAEFLFNTITDAFPLAENAEISIEINPCYVDKDYIFALRQLGFNRISFGIQDFN
SQVQQAVNRIQPEAMLFQVMDWIRQANFDSVNVDLIYGLPHQNLATFRETLRKTAQLNPD
RIAVFNFAYVPWLKPVQKKMPESALPPAEEKLKIMQATIADLTEQGYVFIGMDHFAKPDD
ELAIAQRRGELHRNFQGYTTQPESDLLGFGITSISMLQDVYAQNHKTLKAFYNALDREVM
PIEKGFKLSQDDLIRRTVIKELMCQFKLSAQELESKYNLGFDCDFNDYFAKELSALDVLE
ADGLLRRLGDGLEVTPRGRILIRNIAAVFDTYLQNKSKQQMFSRAI
Download sequence
Identical sequences L8AU63 P74132
gi|383322552|ref|YP_005383405.1| WP_010872841.1.11876 WP_010872841.1.1889 WP_010872841.1.18904 WP_010872841.1.33690 WP_010872841.1.35395 WP_010872841.1.47586 WP_010872841.1.99424 1148.sll1876 gi|383491605|ref|YP_005409281.1| gi|383325721|ref|YP_005386574.1| gi|16330810|ref|NP_441538.1| gi|16330810|ref|NP_441538.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]