SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330857|ref|NP_441585.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330857|ref|NP_441585.1|
Domain Number 1 Region: 757-1004
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.6e-89
Family ABC transporter ATPase domain-like 0.000000842
Further Details:      
 
Domain Number 2 Region: 440-751
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 7.59e-73
Family ABC transporter transmembrane region 0.0000456
Further Details:      
 
Domain Number 3 Region: 4-131
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-21
Family cAMP-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330857|ref|NP_441585.1|
Sequence length 1011
Comment HlyB family protein [Synechocystis sp. PCC 6803]
Sequence
MSLTIADYQSFLREIEPFAQLPAPAIAEIAAKLRPLRFRMGQIILARGKLANNVYFLVSG
QARLLGYDPGTGYPATMALLQNGAVIGDNNAIRNVPCETAIASTETICASLTRDEFLALV
DKYPELARVYRHQCGRVELFDLLGEQLQRTAQGNVDLRQLTLEMLPQSQVYELQPGSHSL
PSDLPDPERLWLVSSGELEQCPRGSALPDPDSALVLKAQTLVRLIGLPPLPRFFPGSSGS
KTNGNGNGHGEVPLATVTRLAPEDSPWDDIPYADPNQLGEPLPEPTVVKSGRKSYPVVRG
QNPTDAGVACFQMISQYFGMPFRRDIIQRIVTEEIKRSEALSLPICGAIVELMGLTSQLV
RIPKGVFGQMQVPFLIRWQDSLALVYEAGDREVKIAVPELGLVKRDTSEFLETWGEEGQG
EVLMMYPSKDTPQQRFGLSWFWPALVKYRYILLLVFVASFFVQLFGLANPLMIQIIIDKV
IVQNSKDTLQVLGIALVSIAIFEALLSTLRTYLFVDTTNRIDMSLGSEIIDHLLRLPLRY
FENRPVGEISTRVNELENIRQFLTGTALTVVLDSVFSVVYIVVMIIYSPLLTAVALGIVP
IFVILTLVFSPLIRRQLRLKAERNAQTQSYLVEVMSGIQTVKAQNIELRSRWQWQDKYSR
YVGAGFNTVITSTLASSSSHFLNQLSGLLVLWVGASLVLDGDLTLGQLIAFRIIAGYVTS
PILRLTQLWQNFQETALSLERLADIVDTPQESERDRQNIPMPEIAGEVKFENVSFRFKKQ
GPLQLNNINLSFPPGTFVALVGQSGAGKSTLTKLLSRLYEPEGGRILVDGLDIGKVELYS
LRRQVGVVPQETLLFEGTVQENIALTNPDATTEQIISAAKVASAHEFIMTLPNGYNTRVG
ERGATLSGGQRQRIAIARSVLQRPRILVLDEATSALDYITEQQVCINLGDAFKDHTVFFI
THRLSSVRSADVIVMMDQGSVVEQGSHDELMALKGRYYYLYQQQGAGGDDV
Download sequence
Identical sequences L8ASV7 P74176
gi|383491652|ref|YP_005409328.1| 1148.sll1180 gi|383322599|ref|YP_005383452.1| WP_010872887.1.11876 WP_010872887.1.1889 WP_010872887.1.18904 WP_010872887.1.33690 WP_010872887.1.35395 WP_010872887.1.47586 WP_010872887.1.99424 gi|16330857|ref|NP_441585.1| gi|16330857|ref|NP_441585.1| gi|383325768|ref|YP_005386621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]