SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330873|ref|NP_441601.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330873|ref|NP_441601.1|
Domain Number 1 Region: 22-241
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.67e-51
Family PP-loop ATPase 0.00048
Further Details:      
 
Domain Number 2 Region: 219-323
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 4.71e-21
Family MesJ substrate recognition domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330873|ref|NP_441601.1|
Sequence length 330
Comment hypothetical protein slr1278 [Synechocystis sp. PCC 6803]
Sequence
MAWTLLHSKLHQNLQRRFPELQGTRILVAVSGGQDSLCLLHLLNDLTKQWQWHLAVAHCD
HRWPTDAGIADHVQGLAQGYKLPYFQRDAQDLPQTEAAARHWRYHALTAIAKAENFPVVM
TGHTQSDRAETLLFNLVRGSGSDGLQAMNWVRNLEESGSDKSPIRLIRPLLEISRQETGD
FCQQQQLSVWEDVLNEKLTYRRNRIRGELIPYLKKHFNPQVEKSLAQTVELLTAEVAYLE
QVSGEIYQTLSQTDQKSLNCRLLSQKPLALQRRIIRQFLQSCQSQSPNFEEIEQIVGLIN
APNRSQTSSLPGQGIVRVEGDFLRYIYQGK
Download sequence
Identical sequences P74192
WP_010872903.1.11876 WP_010872903.1.1889 WP_010872903.1.18904 WP_010872903.1.33690 WP_010872903.1.35395 WP_010872903.1.47586 WP_010872903.1.99424 gi|16330873|ref|NP_441601.1| gi|16330873|ref|NP_441601.1| gi|383325784|ref|YP_005386637.1| 1148.slr1278 gi|383491668|ref|YP_005409344.1| gi|383322615|ref|YP_005383468.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]