SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330880|ref|NP_441608.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330880|ref|NP_441608.1|
Domain Number 1 Region: 345-503
Classification Level Classification E-value
Superfamily Nucleotide cyclase 5.34e-43
Family GGDEF domain 0.00036
Further Details:      
 
Domain Number 2 Region: 201-327
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000593
Family N-terminal PAS domain of Pas kinase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330880|ref|NP_441608.1|
Sequence length 527
Comment hypothetical protein sll1170 [Synechocystis sp. PCC 6803]
Sequence
MSSYLVNETLAVVEEEIDRFLTDFPPDHPYVMALSLSCFRQQLKAKILSTIPNRHKVRTD
EDLEFTSVHGYTGLIEEKLVIEERILRAMPDMIDSLMSRVHQEDSGEIIDQDTQASSLYQ
DRDWWVRVHTIIPCVTYYFGPFTDEKEANKAYPGYLEDLRAEKAIGIFADIKQDCPRNLT
VVDSPADLKQDQRRLWKIYKKIYRQKSVLENSYHNLLELLPGNYLIIDCHGKIQDANQNA
CRLLKTDRESLMGKPFIYYAPQQQISLLENHLENIVKDQSEWQVPYCWSMQLQSLSSISI
SVDIQATQKRNDNGEINGFYWLLNDITSLATINDQLYYDSHHDSLTCLPNRRSLALFLEN
LHQNVHGRNNSDDQAFALLMLDLNKFKSINDRFGHLFGDKVLQRVAEILLECVRDGDQVA
RLSGDEFIIVLKSTKSGDDAKKCADRIHRLFSRPLTMEGIQLLISTSIGIVISNYEQFDY
DRLIDYADTAMYEAKRNGELFVVFDETQPSANGKSHLLPIKNLSLEK
Download sequence
Identical sequences L8AU31 P74197
gi|16330880|ref|NP_441608.1| gi|383325791|ref|YP_005386644.1| 1148.sll1170 gi|16330880|ref|NP_441608.1| gi|383491675|ref|YP_005409351.1| gi|383322622|ref|YP_005383475.1| WP_010872910.1.11876 WP_010872910.1.1889 WP_010872910.1.18904 WP_010872910.1.33690 WP_010872910.1.35395 WP_010872910.1.47586 WP_010872910.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]