SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330902|ref|NP_441630.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330902|ref|NP_441630.1|
Domain Number 1 Region: 238-260,291-640
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.64e-119
Family beta-Lactamase/D-ala carboxypeptidase 0.00011
Further Details:      
 
Domain Number 2 Region: 69-281
Classification Level Classification E-value
Superfamily Lysozyme-like 1.57e-75
Family PBP transglycosylase domain-like 0.00000854
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330902|ref|NP_441630.1|
Sequence length 650
Comment penicillin-binding protein 1B [Synechocystis sp. PCC 6803]
Sequence
MSSTSTLKPSSTKVKAKAQPNFFQRVLCTTGTTFLGVGLVSTAVVAGGVAGLAFSFRNLP
DVRGLTSYVPAQTSYIYDAKGRELLSLHGEEHRKIVPLAEISPNLKRAVLAIEDSNFYKH
QGINPNSIGRALLVNFKSGGVSEGASTLSMQLVKNIYLSQKRVFTRKLAEAVLAIRVEQV
FDKDQILDMYLNYIYWGHNNYGIQTAAESYFKKSAADLDLAESAMLAGMIQAPEAYSPFN
NFTAAKERQEVVLDRMVSIGWITPAEAEAAKKEPLQNKLGQPTAWQNSKLPYVTDAVIAE
LETRFGKEALAQGGLRVQSTVDYDTQKLAEKTVKSAYSGLRGRMGRAKDLQIALVAVEPE
THFIKAMAGGVDYNKSQLNRVTISRRQPGSAFKPFVYYSAFASGKYTPDSSIEDRPISLR
DGAGFYSPKNYGGGFSGSMSIRQAVASSANIPAVLIGSRVGLNKVIEDAKQMGIKTPLQS
VLSLPLGSVDVTPLDMAVGYATLASNGWYSEPTAILRVTNVRGDVLLDNTPKPQQVLDPW
AAASTSSVLTSVVQGGTGKSAYLGRPTAGKTGTTDNERNVWFVGYVPQLATAVWIGDDAN
RSLGKGISGGGYAAPIWRSFMSQAIKNMPVENFPSPSQFPRPKPEKQQKS
Download sequence
Identical sequences L8AU17 P74216
WP_010872930.1.11876 WP_010872930.1.1889 WP_010872930.1.18904 WP_010872930.1.33690 WP_010872930.1.35395 WP_010872930.1.47586 WP_010872930.1.99424 1148.sll1434 gi|16330902|ref|NP_441630.1| gi|383491697|ref|YP_005409373.1| gi|383322644|ref|YP_005383497.1| gi|383325813|ref|YP_005386666.1| gi|16330902|ref|NP_441630.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]