SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330913|ref|NP_441641.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330913|ref|NP_441641.1|
Domain Number 1 Region: 9-226
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-61
Family G proteins 0.00000013
Further Details:      
 
Domain Number 2 Region: 298-398
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.64e-34
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000101
Further Details:      
 
Domain Number 3 Region: 205-301
Classification Level Classification E-value
Superfamily Translation proteins 1.98e-31
Family Elongation factors 0.00000695
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330913|ref|NP_441641.1|
Sequence length 399
Comment elongation factor Tu [Synechocystis sp. PCC 6803]
Sequence
MARAKFERTKDHVNIGTIGHVDHGKTTLTAAITMTLAELGGAKARKYEDIDAAPEEKARG
ITINTAHVEYETDSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLAKQVGVPKLVVFLNKKDMVDDEELLELVELEVRELLSDYDFPGDDIPIVAGSALKAIE
GEKEYKDAILELMKAVDDYIDTPEREVDKPFLMAVEDVFSITGRGTVATGRIERGKVKVG
EEISIVGIKDTRKATVTGVEMFQKTLEEGMAGDNVGLLLRGIQKEDIERGMVLAKPGSIT
PHTEFEGEVYVLKKEEGGRHTPFFANYRPQFYVRTTDVTGTIKSYTADDGSAVEMVMPGD
RIKMTVELINPIAIEQGMRFAIREGGRTIGAGVVSKILK
Download sequence
Identical sequences L8ATW2 P74227
gi|383491708|ref|YP_005409384.1| WP_010872941.1.11876 WP_010872941.1.1889 WP_010872941.1.18904 WP_010872941.1.33690 WP_010872941.1.35395 WP_010872941.1.47586 WP_010872941.1.99424 1148.sll1099 gi|383325824|ref|YP_005386677.1| gi|16330913|ref|NP_441641.1| gi|16330913|ref|NP_441641.1| gi|383322655|ref|YP_005383508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]