SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330918|ref|NP_441646.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330918|ref|NP_441646.1|
Domain Number 1 Region: 104-312
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.86e-59
Family BC ATP-binding domain-like 0.00000509
Further Details:      
 
Domain Number 2 Region: 326-419
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 5.13e-34
Family BC C-terminal domain-like 0.00013
Further Details:      
 
Domain Number 3 Region: 1-102
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.22e-32
Family BC N-terminal domain-like 0.0000515
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330918|ref|NP_441646.1|
Sequence length 419
Comment phosphoribosylamine--glycine ligase [Synechocystis sp. PCC 6803]
Sequence
MKVAVIGSGGREHTLAWSLVRSPEVSHCYCLPGNGGTAGLPKTENVAIAVDQLGEICEFC
QTEKINLVVVGPELPLTLGLTDQLQALGIKVFGPTKAGAELEASKSWTKQLLIEAGVPTA
FGETFTEPAPAQAYATKMGAPIVVKADGLAAGKGVIVAQTSAEATTAIAELFDQGFEKIV
VEEFLPGEEVSVLALCDGKTVIPLLPAQDHKRIGEGDQGLNTGGMGAYCPAPIAPPAVID
QVQKQILQPTANALAKRGIDYRGVLYAGLMVSPTGEIKVLEYNCRFGDPETQAVLPLLAT
PLEKVLMACVEQNLEQLGPLQWHSGNAVCVVVAAGGYPGSYRKGDEINGLAEAEAQDVKV
FHAGTELKEGKVLTNGGRVLGVTALGKDLSTAIATAYRGVEQIDFDGMYYRRDIGHKAL
Download sequence
Identical sequences L8ATV8 P74232
1148.slr1159 gi|16330918|ref|NP_441646.1| gi|383325829|ref|YP_005386682.1| gi|16330918|ref|NP_441646.1| WP_010872946.1.11876 WP_010872946.1.1889 WP_010872946.1.18904 WP_010872946.1.33690 WP_010872946.1.35395 WP_010872946.1.47586 WP_010872946.1.99424 NYSGRC-FDAO-BAA18326 gi|383322660|ref|YP_005383513.1| gi|383491713|ref|YP_005409389.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]