SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330926|ref|NP_441654.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330926|ref|NP_441654.1|
Domain Number 1 Region: 241-751
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 8.93e-151
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000152
Further Details:      
 
Domain Number 2 Region: 36-237
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 3.4e-47
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000598
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330926|ref|NP_441654.1|
Sequence length 767
Comment ribonucleotide reductase subunit alpha [Synechocystis sp. PCC 6803]
Sequence
MHPTLISAPISSSANDAHAGTSQGSHQGHRIQVIRRDGSSTPLNIGKIRAVVDWACLGLE
VNSIALEAGLTTRLREGISTREIQDNLISCALEMCSPNEPDWRYVAGRLHVWSLWKDTLV
RRGYQYGQYLRTVQTKVTNGEYDSRILTYSEGELQEAGCWINSDWDTDYDYAGAVLLTSR
YLLPNELPQEALLTCALLLASVEAPDRRLQWARRFYESIAARRISLATPILANLRVPGGS
LTSCFIVAMEDNLESIFGEITNAARISKNGGGVGVNVSRIRATGSWVMGKPNASGGVIPW
TKLLNDTAIAVNQGGRRAGAVTVGLDVWHLDVPEFLEMQAENGDQRRKAYDIFPQLILPD
EFMRRVINKEDWTLVDPYEVREKMGIELAELWGEQFEGAYREIESNLDTTITLYKRINAR
ELFKQIMRTQVETGMPYLSFKDTINKANPNKHLGYIPGTNLCCESFSNVTPGQDAHCCNL
VSLNLANLDLQDIAGVSQIAVRMLDNTIELTAPPFADAKSHNNKYRTIGVGAMGLADWLA
KRRLNYDELADINRLFEEIGYWCTQSSMELAKERGAYPAFPGSDWQKGLLIGSKPVSWFQ
ANAAKPERWEKLSNDIQTHGIRNSHITAIAPNTSSSLVQGCTASILPVYSRFFYDKWAKG
TVPIAPPFIGNCFWFYPENKTMDQRKVVKAVAAIQQWTDTGISMELLFNLNAGIYFPEEP
ERSLNAKDIFDTLVMAWEAGCKAIYYIRTVQKDDFKDSSDGCVACAN
Download sequence
Identical sequences L8AU02 P74240
gi|16330926|ref|NP_441654.1| NYSGRC-FDAO-BAA18334 1148.slr1164 WP_010872954.1.11876 WP_010872954.1.1889 WP_010872954.1.18904 WP_010872954.1.33690 WP_010872954.1.35395 WP_010872954.1.47586 WP_010872954.1.99424 gi|383491721|ref|YP_005409397.1| gi|383322668|ref|YP_005383521.1| gi|16330926|ref|NP_441654.1| gi|383325837|ref|YP_005386690.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]