SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330932|ref|NP_441660.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330932|ref|NP_441660.1|
Domain Number 1 Region: 24-364
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 1.83e-72
Family Iron-containing alcohol dehydrogenase 0.00000846
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330932|ref|NP_441660.1|
Sequence length 385
Comment glycerol dehydrogenase [Synechocystis sp. PCC 6803]
Sequence
MAPSISPVTQPLVSMAIAPTVVIRSALAKAGEHLQKLGSKGLVVTGSHSAELGEKSLQTL
QKNYGLTLPLASYLPDCAESSLEQLRRRVHQEQPDFILGIGGGKALDTAKLLAHQTQLAI
ATVPTSAATCAGWTALANVYSETGAFRYDVALDRCPDLLIVDYELIQRAEPRLLVAGIGD
AIAKWYEASVSSGQSSDTFTVAAVQQARILRDILFQKSAEALAQPGSETWREVVDASLLM
AGVIGGLGGANCRTVAAHAVHNGLTQLPQAHHALHGEKVAYGILVQLRLEELVSGNQLAA
TARRQLLSFYDEIGLPKTLQDLGLGRISLEELRQTAEFTCLPNSDIHRLPFTVTPETLMA
AMVSTLVEEQGTRQLFAQIQDNSGL
Download sequence
Identical sequences P74246
WP_010872960.1.11876 WP_010872960.1.1889 WP_010872960.1.18904 WP_010872960.1.33690 WP_010872960.1.35395 WP_010872960.1.47586 WP_010872960.1.99424 1148.slr1167 gi|16330932|ref|NP_441660.1| gi|16330932|ref|NP_441660.1| gi|383322674|ref|YP_005383527.1| gi|383325843|ref|YP_005386696.1| gi|383491727|ref|YP_005409403.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]