SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330976|ref|NP_441704.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330976|ref|NP_441704.1|
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.75e-37
Family N-terminal domain of MutM-like DNA repair proteins 0.00057
Further Details:      
 
Domain Number 2 Region: 143-232
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.77e-29
Family Middle domain of MutM-like DNA repair proteins 0.00049
Further Details:      
 
Domain Number 3 Region: 232-283
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.96e-18
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330976|ref|NP_441704.1|
Sequence length 287
Comment formamidopyrimidine-DNA glycosylase [Synechocystis sp. PCC 6803]
Sequence
MPELPEVETVCRGLNRLTLEQTIGGGEVLLDRSLAYPVSVEDFQKQITGCRLVGWQRRGK
YLLGELRSNQAPGPAGWLGCHLRMTGQLLWTERDQQRPRHTRVVLHFEGGWELRFVDTRT
FGKVWLLPGDRPWAEVMTGLGQLGPEPFGADFTAEYLYEKLKSSRRPLKNALLDQRLVAG
LGNIYADEVLFFCGFHPTMASNQVSLQDCELIHQQIQATLTAAIEAGGTSFSDYRQVTGI
NGNYGGMAQVYGREGEPCRHCGTVIAKIKLGGRSAHFCPQCQPKLER
Download sequence
Identical sequences P74290
gi|383491771|ref|YP_005409447.1| gi|16330976|ref|NP_441704.1| 1148.slr1689 gi|16330976|ref|NP_441704.1| gi|383322718|ref|YP_005383571.1| gi|383325887|ref|YP_005386740.1| WP_010873004.1.11876 WP_010873004.1.1889 WP_010873004.1.18904 WP_010873004.1.33690 WP_010873004.1.35395 WP_010873004.1.47586 WP_010873004.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]