SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330982|ref|NP_441710.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330982|ref|NP_441710.1|
Domain Number 1 Region: 199-397
Classification Level Classification E-value
Superfamily PheT/TilS domain 9.42e-67
Family B3/B4 domain of PheRS, PheT 0.00000602
Further Details:      
 
Domain Number 2 Region: 36-200
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.41e-45
Family Myf domain 0.0023
Further Details:      
 
Domain Number 3 Region: 486-699
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.64e-41
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000949
Further Details:      
 
Domain Number 4 Region: 711-809
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.57e-28
Family Anticodon-binding domain of PheRS 0.00051
Further Details:      
 
Domain Number 5 Region: 412-493
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000412
Family Domains B1 and B5 of PheRS-beta, PheT 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330982|ref|NP_441710.1|
Sequence length 810
Comment phenylalanyl-tRNA synthetase subunit beta [Synechocystis sp. PCC 6803]
Sequence
MRISVNWLQSLVELNLSPEELGELLTIAGLEVEEIEDRRSWAAGVVLGRVISREKHPNAD
KLSVCVVDIGTEEPSTIVCGAANVRADILVPVATLGSYLPKVDLKIKPAKLRGVKSSGMI
CSLAELGLSKESEGIHIFPDLDLPSGSPVGPLLGLDDVILEISPTANRADALSMVGVARE
VAALTGGKLSLPEIKAVSVSDQDLPISVTEPQACPTYVGTVIRGVKVGPSPDWLQQRLLA
AGTRPINNVVDVTNYVLLEWGQPLHSFDQDKLQTLVGPEGFALGVRFAEEGEKLITLDDQ
ERTLQPQNLLVTANDQPVAIAGVMGGAATEVDENTQNIVLETALFDGVTIRKSSKAINLR
SESSTRYERGVNRCELEVALHRAIALMTELAGGTVVRQGKADQRQDRGEAIINLRLERLQ
QLLGKVNTPTGIGNITAEDVERILTDLGCGLTRQSDSDTPVWAVTVPSYRQRDIEREIDL
IEEVARLYGYDHFCEQLPSNTIAGGLSPSYQAELALREACRGVGLTEVVHYSLVKPHGSE
VMLANPLFAEYSALRTNLLDGLITAFANNQAQNNGALNAFEVGRVFWQNEGDIGEADHLA
GICGGSQITEGTWPQGGKPQPMSWYDAKGLLEAIFQRLGATVTYSGDHQDPRLHPGRTAL
LSCNGTVLGRFGQLHPQLRREKGLIDEVYAFEITLTPLYQAMETQILGTPDFRPYSPYPA
VARDLALYAPLELTVAELTQAMVKAGGDLLEQVELFDEYRGQSVPAGQRSLAFSLAYRVG
DRTLTDADVEPLHNQIREALTKQFAVSLRS
Download sequence
Identical sequences L8ATR8 P74296
gi|16330982|ref|NP_441710.1| 1148.sll1553 gi|383322724|ref|YP_005383577.1| gi|383491777|ref|YP_005409453.1| gi|16330982|ref|NP_441710.1| WP_010873010.1.11876 WP_010873010.1.1889 WP_010873010.1.18904 WP_010873010.1.33690 WP_010873010.1.35395 WP_010873010.1.47586 WP_010873010.1.99424 gi|383325893|ref|YP_005386746.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]