SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331017|ref|NP_441745.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331017|ref|NP_441745.1|
Domain Number 1 Region: 2-186
Classification Level Classification E-value
Superfamily ITPase-like 9.81e-53
Family Maf-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331017|ref|NP_441745.1|
Sequence length 195
Comment Maf-like-protein [Synechocystis sp. PCC 6803]
Sequence
MPPTFVLASASPARKRLLEMAGISPLVAVSHFDESSLAADNTVALVEALAKAKAGTVASK
FADALVLGCDSLLLVNGQTYGKPESPAVAIARWQTMRGQVGELYTGHALIDRTQNRCLCQ
TGLTKVHFADVDDDTIQAYVGSGEPLQCAGAFALEGKGGMLINKLDGCSSNVIGLSLPIL
RSLLQRLGYSLKDFW
Download sequence
Identical sequences L8ATQ1 P74331
gi|16331017|ref|NP_441745.1| gi|383322760|ref|YP_005383613.1| gi|383491813|ref|YP_005409489.1| gi|16331017|ref|NP_441745.1| WP_010873046.1.11876 WP_010873046.1.1889 WP_010873046.1.18904 WP_010873046.1.33690 WP_010873046.1.35395 WP_010873046.1.47586 WP_010873046.1.99424 gi|383325929|ref|YP_005386782.1| 1148.sll0905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]