SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331045|ref|NP_441773.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331045|ref|NP_441773.1|
Domain Number 1 Region: 624-843
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.81e-32
Family Spore coat polysaccharide biosynthesis protein SpsA 0.023
Further Details:      
 
Domain Number 2 Region: 4-362
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 7.53e-21
Family Glycosyl transferases group 1 0.024
Further Details:      
 
Weak hits

Sequence:  gi|16331045|ref|NP_441773.1|
Domain Number - Region: 332-483
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0732
Family Neurolysin-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331045|ref|NP_441773.1|
Sequence length 996
Comment hypothetical protein sll1528 [Synechocystis sp. PCC 6803]
Sequence
MKVLITDFDLFAKVGGGQTFYRSLIRKNPDIDFYYLIDKEARVTERPDNAHGVPFQEKYF
LADLNNFFDVNPPKWVYRSFIRASNIATSVAGMEFDLIDSPDYEQWAIFLRPALDYHRVK
FAKIALSLHGKISTTLKLDWFNQGKENIPLELEEWKQYATVDLRYGISKSYIDEWQSLSR
FSAHYYHPLHFFELPQPLEAIASGDRPDLNFVGRTEKRKGPDIFIDIAWWLNRNLYHEAN
IIGPHSFNDTGTISSETYLRSMLGDRQSPVKFLPPKPQQELMGLFARKTVTFVPSRYDTL
NLVALESLFSGCPTVVGGGAGVCRLLKEDFPDVPFVEIDLDNIYSCLPAIENILSDYNNY
RRRLVDSVKNSTAIADSPILADIYQQTGQYEEEIRDELQSWYGQLMGYWVSTQENVSFLQ
PLKAQLKPTLKQIKNNLKSTAGQLKGKILQPLADDRNAQLVKAPNLLKKYKEAFNATEQT
AKDLAEKIQMGWRLGSGYESEFQGVRGKLATNYRIDRVRLWRELARIEELRGNTLVSATY
KVRALRALGSDQFGDLPFVLRTLTEYGFPKEMAAVSALYGQPSEREERCLSLIEQARLDN
LANPAGDEYEIWDDRRGDGPYRASIIVSLYNAAAKLPLFLKTLQHQTLIKRGEAEVVLVD
SGSPGNEYEVFKDLAPTLGYPLLYARSPQRETIQSAWNRGIKLAKSPYLAFLGVDETILP
DCLEILAGELDQDPELDWAIGHSLVTNVDMQGGWVSDIMPYDRTGYEQDLVYLETCYLSW
VGALYRKSIHERFGYYDQSFRGAGDTEFKNRVMPFIKSKVVDKMLGLFWNYPDERTTQSP
ATEIEDMRAWYLHRTLAGVKYAFQRRSPREVENLLYHCLGYRKSYCKHTSTDFDHAHNLV
TYLEKVDPNAEALKYAPGIEALLGTYRSLDWLPKLSKFSPLNSMLTARKLTKQWEQEHQQ
SWPEDRLFSPHYSIFNDNRHEQHSFLWFTDITASKK
Download sequence
Identical sequences L8APZ5 P74358
gi|16331045|ref|NP_441773.1| gi|383491840|ref|YP_005409516.1| WP_010873073.1.11876 WP_010873073.1.1889 WP_010873073.1.18904 WP_010873073.1.33690 WP_010873073.1.35395 WP_010873073.1.47586 WP_010873073.1.99424 gi|383325956|ref|YP_005386809.1| gi|383322787|ref|YP_005383640.1| gi|16331045|ref|NP_441773.1| 1148.sll1528 NYSGRC-FDAO-BAA18453 SgR107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]