SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331055|ref|NP_441783.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331055|ref|NP_441783.1|
Domain Number 1 Region: 5-144
Classification Level Classification E-value
Superfamily RNase III domain-like 2.62e-41
Family RNase III catalytic domain-like 0.00037
Further Details:      
 
Domain Number 2 Region: 106-126,155-231
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.83e-24
Family Double-stranded RNA-binding domain (dsRBD) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331055|ref|NP_441783.1|
Sequence length 231
Comment ribonuclease III [Synechocystis sp. PCC 6803]
Sequence
MNHPDFPPIGDPQLKLEALTHRSYCNEHPGTPSYDRLEFLGDAVLGFVVGRILFERYPHF
TEAELTRLRSQLVNQNQLAYLARFLHIAPEIRLSQSLARDDGQSSPSILADVFESLLGAA
LLDRGLTAVEDFIQELFVPILEQWEKSQDGRSPKLVPTMDVKSMLQQWALAKTKQLPEYE
LINTSGPPHAQEFTFTVKVAGKIHGQGSGPSKQIATKQAALEALKSLGLLQ
Download sequence
Identical sequences L8APY6 P74368
gi|383322797|ref|YP_005383650.1| gi|383491850|ref|YP_005409526.1| SgR247 gi|16331055|ref|NP_441783.1| gi|16331055|ref|NP_441783.1| WP_010873083.1.11876 WP_010873083.1.1889 WP_010873083.1.18904 WP_010873083.1.33690 WP_010873083.1.35395 WP_010873083.1.47586 WP_010873083.1.99424 gi|383325966|ref|YP_005386819.1| 1148.slr1646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]