SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331077|ref|NP_441805.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331077|ref|NP_441805.1|
Domain Number 1 Region: 4-104
Classification Level Classification E-value
Superfamily Urease, beta-subunit 3.66e-50
Family Urease, beta-subunit 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331077|ref|NP_441805.1|
Sequence length 105
Comment urease subunit beta [Synechocystis sp. PCC 6803]
Sequence
MATMIPGEIITPEGDIELNVGRSTCTINVANTGDRPIQVGSHYHFYEVNAALQFDRDLAK
GMRLDIPAGTAVRFEPGDEKNVNLVAYAGSREIYGFNGLVNGPLE
Download sequence
Identical sequences P74386
gi|383322820|ref|YP_005383673.1| gi|383491873|ref|YP_005409549.1| 1148.sll0420 gi|16331077|ref|NP_441805.1| gi|383325989|ref|YP_005386842.1| gi|16331077|ref|NP_441805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]