SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331091|ref|NP_441819.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331091|ref|NP_441819.1|
Domain Number 1 Region: 1332-1575
Classification Level Classification E-value
Superfamily EAL domain-like 2.48e-88
Family EAL domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1155-1318
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.73e-45
Family GGDEF domain 0.00015
Further Details:      
 
Domain Number 3 Region: 858-1013
Classification Level Classification E-value
Superfamily GAF domain-like 1.42e-26
Family GAF domain 0.019
Further Details:      
 
Domain Number 4 Region: 1027-1142
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.32e-20
Family Heme-binding PAS domain 0.089
Further Details:      
 
Domain Number 5 Region: 702-826
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.32e-19
Family Heme-binding PAS domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331091|ref|NP_441819.1|
Sequence length 1578
Comment hypothetical protein sll0267 [Synechocystis sp. PCC 6803]
Sequence
MSIMPPPPSSVPPHQGHGFWRGAVLLVLIFLIIFGGVAVAHWRIEMVSQQMRQQLLSQVE
MVSLNLNFRLFQELSFTPQDLENPSFQRLHNQMAAYAQTFEHRSIYTMVIRSGKILFGPD
SLKSGDFLARDPGAVYKNPPEAVRQLFELPSKKLVIGPYHSERGNFVSAYAPILQPQSER
VLVIVAMDMEARQWHQKLQQKLWTPLLFSVGLIALILGGDYLLQERRRWRNSFITNQGEA
LATAIVGLFLTLALTAVVQENSLLNSQRNFSQLAIPRANLFAQKLWELQNYGLSSLNSFM
ESSAEVTRAEFARFTLPMIRKLSIQAWEWIPKVTAADRENFERRARQDGIENFQIFELNR
RGKPVPAEGREVYYPIFYAEPLAGNDIALGFDVSSNESAKMALDEALENRLPTATNPLTL
IQELGKQRGIVAYSPVFADGNLENPPMGVAAVVLRLNDFLTQTFGEISFGDKSLELQWLQ
LSVDRSPLVLASSAPSPFSMNNWQSNKELFQVYPLFIFGRAYALLLWPGPEFNQNYPKQM
AMVAFGVGTGITVLVTIIVAIITNSQANLTHQIRQRTKELRATLGQLRERVKEMDCLVAI
AQMGQQADLVLEEFLQNTVDLLPLAFRYEKLASARLTWGNSIYQSPNYQKTDYCLIAEFQ
TEHFHRGQLEVCYGEERDFLPEEKALLNTVSQFLSRFLESHYTEIILERNERNYREIFNS
THEAIFIQDAHQATVLDVNQPMLTMYGYGNKEEVIGRPIGDFSADKPGKTEAEIEQKLRQ
ARNAEPQMFEWLAKKQDGSLFWAEVSIQPTVIDGKSRLLAVVRDISERKQNQQRIEYLSR
LYATLSQVNRAIIENRERDDLFRAICDVGVAVGQFSLIWFGLIDPDRQTIIPYMAGGHTT
AYLENIRITFKDEPAGRGPTGTAAREGRLVICSNISQDPKMAPWRGSAMRYGFLSSAAVP
IRQGGQVVAVLTFYSQEAGFFSEDEQDLLQEISDNLSFALDAIQLDQANQRAQNQLGENE
ERLRLALEAANQGFYDLNLQTGQAVVSPQYGQILGYDPQYFQETEQRWLERIHPQDQQRV
REIYDQYIQGKIPRYAVECRQRTMAGQWKWLLSLGKIVEWDSQGKPLRMLGILTDVTERK
QAEAQIENLAYYDPLTALPNRRLLLDRAENALALAQRSKHFGAIVLIDLDGFKTLNDARG
HDSGDRLLQMVAKRLADSLRDSDTVARLGGDEFIVLLPELAHDRELAARLGLGVGEKIRQ
ALATPFTLEAEQVQISGSIGITLFPKLNEKVSDLFKEADTAMYQAKKAGRDKVCLFESQM
QLEVESRFALEADLRSALEQKQFQVYLQPQVDSHGVWIGAEALLRWNHPGRGFIPPNIFI
PIAEEIGLIGGIGDFVLEQVCQYLARLQQLGLTLRIAINVSPRQFRQANFAKEIKNLLAC
TGVDPYRLTLEVTEGLIVEDTHQAIATMFELQTLGIHFSVDDFGTGYSSLSYLKRLPLNE
LKIDRAFVQDAPQDLNNAALVEAIISVARTFNLAIVAEGVETEEQVQFLAQLGCNFYQGY
FYGRPMPIDEFHQKLTAS
Download sequence
Identical sequences P74400
SgR205 gi|383491887|ref|YP_005409563.1| WP_010873120.1.11876 WP_010873120.1.1889 WP_010873120.1.18904 WP_010873120.1.33690 WP_010873120.1.35395 WP_010873120.1.47586 WP_010873120.1.99424 gi|383322834|ref|YP_005383687.1| 1148.sll0267 gi|16331091|ref|NP_441819.1| gi|16331091|ref|NP_441819.1| gi|383326003|ref|YP_005386856.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]