SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331126|ref|NP_441854.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331126|ref|NP_441854.1|
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily ITPase-like 1.47e-64
Family ITPase (Ham1) 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331126|ref|NP_441854.1|
Sequence length 194
Comment deoxyribonucleotide triphosphate pyrophosphatase [Synechocystis sp. PCC 6803]
Sequence
MPTLIVATGNPGKLAEMQTYLEPLGCQLTLKPTEIEVEETGSTFYENACLKASQVAKAVN
QWAIADDSGLAVDALDGAPGLYSARYGNTDRERIAKLLQALEGVSQRQAQFICVVSIAAP
DGSIQLSTKGICSGEITHSPRGDQGFGYDPIFWLPEHKKTFAEMTKVEKQKVSHRGKAFN
KLIHQWPGLKFDSF
Download sequence
Identical sequences L8AT66 P74432
1148.slr0402 WP_010873155.1.11876 WP_010873155.1.1889 WP_010873155.1.18904 WP_010873155.1.33690 WP_010873155.1.35395 WP_010873155.1.47586 WP_010873155.1.99424 gi|383491922|ref|YP_005409598.1| gi|16331126|ref|NP_441854.1| gi|16331126|ref|NP_441854.1| gi|383326038|ref|YP_005386891.1| gi|383322869|ref|YP_005383722.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]