SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331156|ref|NP_441884.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331156|ref|NP_441884.1|
Domain Number 1 Region: 823-1049
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.05e-46
Family Multidrug efflux transporter AcrB transmembrane domain 0.00014
Further Details:      
 
Domain Number 2 Region: 303-514
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 8.24e-31
Family Multidrug efflux transporter AcrB transmembrane domain 0.00019
Further Details:      
 
Domain Number 3 Region: 47-141
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.96e-18
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0042
Further Details:      
 
Domain Number 4 Region: 142-188,280-338
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.26e-16
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.01
Further Details:      
 
Domain Number 5 Region: 740-825
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000103
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0098
Further Details:      
 
Domain Number 6 Region: 190-278
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000222
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0053
Further Details:      
 
Domain Number 7 Region: 586-665
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000149
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331156|ref|NP_441884.1|
Sequence length 1075
Comment cation or drug efflux system protein [Synechocystis sp. PCC 6803]
Sequence
MSSPNSVFSLSGLAIRRHIATLMLTLAIIVLGVFAVFSLPVDLLPSITYPRIGVRLDAPG
VSPEVAVDEITRPLEAALSATEGVVQVYSQTREGQISLDLFFEPGGNIDQALNDATATFN
RARNQLPDDLETPRLFKFDPSQLPVYEFAVTSPELSGPSLRVFAEEELARELGVVPGVAS
VNVSGAAQEEVRINVDLQRLQRSGVSLTQVLDALQSRNVDISGGRIVGTESEPLTRTVGR
FASAQEIEDLVVGTVSGLEDQSAQKVYLRDVATVIDGTEEERIFVTLNGNPAVKVSVQKQ
PEANTIEVVDGVKKRLEELRTEGIIPQAAELTPTLDDSVFIRNSVNNVVVSGLIGTVLAA
IAVLLFLGSLRQTLIIVLAIPLATMAAIIVMKAFGLSLNVFSLGGLALGVGIVVDNSIVM
LETIAEGAGMTPGKVNPLPLTKGEMRNQAIASSQTVESALVASTSTNLVAVLPFLMIGGF
IALIFNELILTISFAVAASILVAVTLVPMAASRLLAIRRRSGLGNWLFFREFNRRFAGAT
AAYARFLSILIRHRLVAVASIFIVFGGSSLWMIGQIPQEILPRINTGQASMFAQFPPGTP
LEENQRLMAIVDDILINQPETEYAFTTVGGFLFGSNVNANALRSSSTITLKPNTDVEAFT
ERVTAELEALNLVDIRLRMAPGQLRGLILSNSPLRNVDVDVVLQGNDADVLDEAGRAVLA
ELGEKVTLARFRPDADPRQPEVQIRPDWQRATELGLTTQAIGQTVQTALDGAVPTQLQRE
NRLVDVRVKLDNDLLSGPGDLAQIPLFIDGDRPIRLGDVATIDQGRAPGEIQRINQRPVF
LIAGTLVEGASLSEALTEVDQVLSAMEFPPGVSRLPSTAAASNEQLQSSLVILGGLAAFL
VFVVMAVQYNSLLDPLVIMFTLPLALAGGILGLYVTQTAIGATVIVGTVLLVGIVVNNAI
IMVELANQIWAEEGISREAAILRAAPQRLRPILMTTITTVLGMFPLALGIGQGSELLQPL
GIVVFSGLSLATLLTLFLIPCLYVLLHQWEGVDIEKVKTDLESRLTEEDVPTKIQ
Download sequence
Identical sequences L8AT67 P74461
gi|383491952|ref|YP_005409628.1| WP_010873185.1.11876 WP_010873185.1.1889 WP_010873185.1.18904 WP_010873185.1.33690 WP_010873185.1.35395 WP_010873185.1.47586 WP_010873185.1.99424 gi|383326068|ref|YP_005386921.1| gi|16331156|ref|NP_441884.1| gi|16331156|ref|NP_441884.1| 1148.sll0142 gi|383322899|ref|YP_005383752.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]