SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331172|ref|NP_441900.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331172|ref|NP_441900.1|
Domain Number 1 Region: 9-439
Classification Level Classification E-value
Superfamily Clc chloride channel 2.62e-101
Family Clc chloride channel 0.0000016
Further Details:      
 
Domain Number 2 Region: 450-571
Classification Level Classification E-value
Superfamily CBS-domain pair 8.46e-34
Family CBS-domain pair 0.00046
Further Details:      
 
Domain Number 3 Region: 600-731
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000000000000193
Family Universal stress protein-like 0.0078
Further Details:      
 
Domain Number 4 Region: 748-878
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000293
Family Universal stress protein-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331172|ref|NP_441900.1|
Sequence length 899
Comment chloride channel protein [Synechocystis sp. PCC 6803]
Sequence
MAWFPFWQRWQQWLRSRHYGRTAIDSRYAIAEACVIGFVSALAALVIKNGVNWLGSSRLS
LADTYGAIWVLPCFGLVFGGLAGALIEQFSRPAGGGGIPQVKAALARYPIPLDWRVAVVK
LLGTVLVLGGGMTLGRRAPTVHIGAALAAQLSRWFPTSPEHRRQMIAAGAAAGLAAGFTT
PIAGVLFVVEELMRDVSSLTLETAIVASFVGAVTSLVFQSSDLNLAHSLSNSPTVRFTTG
EIPFYLLLGILAGILGVLLNRSILSLQNWQRKQNLSLVIRIGVVGLISGVAIALLPSFFR
DNAGLREFVTSGELSWHQVVLTLVAHFILTILAYSTDAPGGLFAPALVMGSALGYLVGEF
GSYWQDQVTQTTFALAGMGAFFTSVVRVPVTAIIIVFELTGNFNVVLPLMVACATSYLVA
ESLFPRSLYDHLLETKGIFLAEEKPDHDFLADIRAGQVMKTEVESLEQSLTLAQVLPIMS
NSHHRGFPVVQGGKLVGVFTQTDLANAAQESVHIALKQIMTPNPITVDPEAPLSDVLYLL
NRYQLSRLPVVEGDNKLVGIITRTDIIREEVSQLGGQIIHPPHPAYSVYQTRSPLVGEGR
ILLPIRDSDSALVLFQIAAAIAKKQNYEIDCLQVVKVSKAQSPSVQRVQWQRQRQLMQKL
ERIARHQRVLFHTEIKLAYSITDTILDTIQTRHSDLLILEWQGEMPIGGQIFGQITDRLI
DQAPCSLLMVKQGTNDHAYPRYLSPMAHWLMPVAGGPNIEKMLNLLPALFSLYPEENNPQ
LLISKVYLPRQSQRYDPFYDLKNLAERWSEQLQRPIIPIPVCSTSIADALSDLAEMRECA
AIVLGASREGLLKNVIHGNLPTQIASQTNTTVFIFRGPVDSPNEEAIVPPLAPDFGLDE
Download sequence
Identical sequences P74477
gi|383322915|ref|YP_005383768.1| gi|383491968|ref|YP_005409644.1| 1148.sll1864 gi|16331172|ref|NP_441900.1| WP_010873202.1.11876 WP_010873202.1.1889 WP_010873202.1.18904 WP_010873202.1.33690 WP_010873202.1.35395 WP_010873202.1.47586 WP_010873202.1.99424 gi|383326084|ref|YP_005386937.1| gi|16331172|ref|NP_441900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]