SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331207|ref|NP_441935.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331207|ref|NP_441935.1|
Domain Number 1 Region: 76-250
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.42e-20
Family Matrix metalloproteases, catalytic domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331207|ref|NP_441935.1|
Sequence length 261
Comment hypothetical protein slr1946 [Synechocystis sp. PCC 6803]
Sequence
MNKKIKLWGWCLALFLLTLLLVSLPAIANNGSKQALPELQIHPLPPELVDLGISLENRSL
LGDDGTDYFSQVQPSPLGYLLWSKFPVTVAVDYPPGLTPGSAAQKRYYTWQQAIKTAIAD
WQEFFPLTIVENTTEADITIFYREPPLPRIVDPETGLVSFGRARTAQANYEFYWTDTSPP
QLRHRMAIAIKPGLAPLSLQGTARHELGHALGIWGHSDHKEDALYPAQTADVPAISPRDL
RTLYRLYQQPTRLGWSVLVSN
Download sequence
Identical sequences P74509
gi|383322950|ref|YP_005383803.1| 1148.slr1946 WP_010873235.1.11876 WP_010873235.1.1889 WP_010873235.1.18904 WP_010873235.1.33690 WP_010873235.1.35395 WP_010873235.1.47586 WP_010873235.1.99424 gi|16331207|ref|NP_441935.1| gi|383492003|ref|YP_005409679.1| gi|383326119|ref|YP_005386972.1| gi|16331207|ref|NP_441935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]