SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331228|ref|NP_441956.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331228|ref|NP_441956.1|
Domain Number 1 Region: 38-140
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.75e-23
Family Pentapeptide repeats 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331228|ref|NP_441956.1|
Sequence length 169
Comment hypothetical protein sll0301 [Synechocystis sp. PCC 6803]
Sequence
MSSFLVFSWRRWLQILILAIALVLLWAPSALAQANTVNYTYGDLARSDFSHQDLNKAVFA
AADLRESNFEGSDLSFSILTDAVFLHASLRGANLSGSLVDRVTLDFADLRDTIFTEAIAT
RTRFYDTDITGADFSDAVIDAYQVKLMCERAEGVNPVTGVATRDSLGCR
Download sequence
Identical sequences Q55531
gi|383326140|ref|YP_005386993.1| gi|383492024|ref|YP_005409700.1| gi|16331228|ref|NP_441956.1| gi|16331228|ref|NP_441956.1| gi|383322971|ref|YP_005383824.1| 1148.sll0301 WP_010873256.1.11876 WP_010873256.1.1889 WP_010873256.1.18904 WP_010873256.1.33690 WP_010873256.1.35395 WP_010873256.1.47586 WP_010873256.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]