SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331260|ref|NP_441988.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331260|ref|NP_441988.1|
Domain Number 1 Region: 7-286
Classification Level Classification E-value
Superfamily Folate-binding domain 1.73e-89
Family Aminomethyltransferase folate-binding domain 0.00000146
Further Details:      
 
Domain Number 2 Region: 278-369
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 4.74e-27
Family Aminomethyltransferase beta-barrel domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331260|ref|NP_441988.1|
Sequence length 372
Comment glycine cleavage system aminomethyltransferase T [Synechocystis sp. PCC 6803]
Sequence
MANLFPALRTPLYNLITEQTTKLTTFGGWEMPVQFAGLKQEHQAVREKVGMFDISHMGKF
VLTGQKVLAALQSLVPSDLDRLTPGKAQYTVLLNAQGGIIDDIIVYDQGKNPEGQERVTL
IVNAATTVKDKQWLLEHLPEEIDFQDLSREKVLIALQGPEALTILQPLVDQNLGELPAFG
HLEAEFLREKAFIARTGYTGEDGFEIMVSPEVGKQLWQTFGSKGVTPCGLGARDTLRLEA
GMGLYGQDMNDETTPLEAGLGWLVHLDSKGDFIGRAVLTEQKANGVEKRLVGLEMLAKQI
ARHDYPILHNGEIMGIVTSGTLSPTLQKAIALGYVPTELAKVGQELEVEVRGKTYGIKVV
KKLFYRSEQKPR
Download sequence
Identical sequences P54261
1148.sll0171 gi|383323003|ref|YP_005383856.1| gi|383492056|ref|YP_005409732.1| gi|16331260|ref|NP_441988.1| gi|383326172|ref|YP_005387025.1| WP_010873287.1.11876 WP_010873287.1.1889 WP_010873287.1.18904 WP_010873287.1.33690 WP_010873287.1.35395 WP_010873287.1.47586 WP_010873287.1.99424 gi|16331260|ref|NP_441988.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]