SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331265|ref|NP_441993.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331265|ref|NP_441993.1|
Domain Number 1 Region: 278-534
Classification Level Classification E-value
Superfamily HemD-like 8.24e-70
Family HemD-like 0.0034
Further Details:      
 
Domain Number 2 Region: 33-265
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 1.03e-61
Family Tetrapyrrole methylase 0.00000734
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331265|ref|NP_441993.1|
Sequence length 538
Comment uroporphyrin-III synthase [Synechocystis sp. PCC 6803]
Sequence
MAEKLPHPQCLGVPGRSPRRESNLIFTMLSTDSRAKVYLMGAGLGPVAYLTQRAIAVLGR
ANVVIYDALVSQELFDLLPPDCERIFVGKRGGQPSTPQAKINQLLVDHYRRGKQVVRLKS
GDPWIFGRIMPELATLVTHHCAYEVVPGISSAIAGAGLASIPLTAKDSGAGFFVMDGHDP
HRWPWPALAQLPTLVILMGTKNLSLLVNELVRAGKSPHTPMAVIKNAGRPEQQTWEGTLA
DMVEKTQGQSLAPAVIVIGDVVSQRIIPALPPLPLTEKTILVTRAADQASQFTELLHQQG
ATVLAMAALEIVPPKDWQPLDQAIAKLGDFDWLILTSANGVEFFFQRLQHHGLDSRALAG
LKLAVVGKKTAQSLEKFGLKPDFIPPDFIADALVEHFPHSPAGLKILFPRVESGGRAQLV
QELSQKQALVTEVPSYQSACPGHMPEEVWQSIVNQTVDVITFASSKTVSHFRQLLAQTSQ
ANGYQDWRSLINHCQIASIGPQTSERCLRELGRVDIEATEYTLEGLTGAITNYVYQNP
Download sequence
Identical sequences Q55562
gi|383492061|ref|YP_005409737.1| gi|383326177|ref|YP_005387030.1| gi|383323008|ref|YP_005383861.1| gi|16331265|ref|NP_441993.1| WP_010873292.1.11876 WP_010873292.1.1889 WP_010873292.1.18904 WP_010873292.1.33690 WP_010873292.1.35395 WP_010873292.1.47586 WP_010873292.1.99424 gi|16331265|ref|NP_441993.1| 1148.sll0166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]