SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331275|ref|NP_442003.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331275|ref|NP_442003.1|
Domain Number 1 Region: 183-642
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.64e-118
Family Amylase, catalytic domain 0.00000000513
Further Details:      
 
Domain Number 2 Region: 650-752
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.88e-36
Family alpha-Amylases, C-terminal beta-sheet domain 0.00042
Further Details:      
 
Domain Number 3 Region: 15-118
Classification Level Classification E-value
Superfamily E set domains 1.03e-18
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 
Domain Number 4 Region: 141-198
Classification Level Classification E-value
Superfamily E set domains 0.0000000091
Family E-set domains of sugar-utilizing enzymes 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331275|ref|NP_442003.1|
Sequence length 770
Comment glycogen branching protein [Synechocystis sp. PCC 6803]
Sequence
MTYTINADQVHQIVHNLHHDPFEVLGCHPLGDHGKVNQWVIRAYLPTAEAVTVLLPTDRR
EVIMTTVHHPNFFECVLELEEPKNYQLRITENGHERVIYDPYGFKTPKLTDFDLHVFGEG
NHHRIYEKLGAHLMTVDGVKGVYFAVWAPNARNVSILGDFNNWDGRLHQMRKRNNMVWEL
FIPELGVGTSYKYEIKNWEGHIYEKTDPYGFYQEVRPKTASIVADLDGYQWHDEDWLEAR
RTSDPLSKPVSVYELHLGSWLHTAYDEPVKTLHGEGVPVEVSEWNTGARFLTYYELVDKL
IPYVKELGYTHIELLPIAEHPFDGSWGYQVTGYYAPTSRFGSPEDFMYFVDQCHLNGIGV
IIDWVPGHFPKDGHGLAFFDGTHLYEHGDPRKGEHKEWGTLIFNYGRNEVRNFLVANALF
WFDKYHIDGMRVDAVASMLYLDYCREEGEWVANEYGGRENLEAADFLRQVNSVVYSYFPG
ILSIAEESTSWPMVSWPTYVGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNSITFSMW
YNHSENYMLALSHDEVVHGKSNMLGKMPGDEWQKYANVRALFTYMFTHPGKKTMFMSMEF
GQWSEWNVWGDLEWHLLNFPPHQQLKQFFTELNHLYKNEPALYSNDFDESGFQWIDCSDN
RHSVVSFIRRAKNSAEFVVTICNFTPQPHSHYRVGVPVPGFYTELFNSDARQYGGSNMGN
LGGKWTEEWSFHEQPYSLDLCLPPLSVLVLKLSQNAEENTVPAEEASNIA
Download sequence
Identical sequences L8ASP4 P52981
1148.sll0158 gi|16331275|ref|NP_442003.1| gi|383326187|ref|YP_005387040.1| WP_010873301.1.11876 WP_010873301.1.1889 WP_010873301.1.18904 WP_010873301.1.33690 WP_010873301.1.35395 WP_010873301.1.47586 WP_010873301.1.99424 gi|383492071|ref|YP_005409747.1| gi|16331275|ref|NP_442003.1| NYSGRC-FDAO-BAA10073 gi|383323018|ref|YP_005383871.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]