SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331293|ref|NP_442021.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331293|ref|NP_442021.1|
Domain Number 1 Region: 263-422
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.85e-37
Family Histidine kinase 0.0013
Further Details:      
 
Domain Number 2 Region: 184-260
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000053
Family Homodimeric domain of signal transducing histidine kinase 0.004
Further Details:      
 
Weak hits

Sequence:  gi|16331293|ref|NP_442021.1|
Domain Number - Region: 64-140
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0012
Family Heme-binding PAS domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331293|ref|NP_442021.1|
Sequence length 430
Comment regulation of the phosphate regulon [Synechocystis sp. PCC 6803]
Sequence
MEIITLAIGGAIGFGIGAIERFRLNNKIKKLLTGLPDTQEVSHSLSLVSLVRREINHLND
LCAEYLDTIAHWRGVMSLSPLGYLLIDQENNLEWCNPAAESLLHIRYWQPGERRLFLEFI
RSYELDQLIECTRQTQTNQTREWSFFPPLTAAMEGWGNHRPLTPESILLRGSGFPLKEGK
VAVFVENRQTLAALRQGRDQAFSDLAHELRTPLTAVALIAERLQARLPAEDGDWAERLLK
EISRLQNLVESWLHLTQITANPNLYLEPEPINLRHLLAITWERLTPIAVVKNITLDYQGP
TKLNLEGDGDRLMQVLMNILDNTLKYSPPEGTIFVQGHQGTEGITMIIRDQGLGFQPRDL
PYIFERLYRGDSSRARLHPDSQRHGSGLGLAIAKEIVLAHRGNLTAANHETGGAMFTIEL
PYEPNMDENP
Download sequence
Identical sequences L8ARM6 Q55586
gi|383323035|ref|YP_005383888.1| 1148.sll0337 gi|16331293|ref|NP_442021.1| WP_010873319.1.11876 WP_010873319.1.1889 WP_010873319.1.18904 WP_010873319.1.33690 WP_010873319.1.35395 WP_010873319.1.47586 WP_010873319.1.99424 NYSGRC-FDAO-BAA10091 gi|383492088|ref|YP_005409764.1| gi|16331293|ref|NP_442021.1| gi|383326204|ref|YP_005387057.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]