SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331339|ref|NP_442067.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331339|ref|NP_442067.1|
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily Ribosome-binding factor A, RbfA 5.76e-35
Family Ribosome-binding factor A, RbfA 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331339|ref|NP_442067.1|
Sequence length 133
Comment ribosome-binding factor A [Synechocystis sp. PCC 6803]
Sequence
MATSRRVSRVSSLIKREVSQMLLHEIKDDRVGTGMVSVTEVEVSGDLQHAKIFVSIYGSP
EAKASTMAGLHSAAPFVRRELGQRMRLRRTPEVSFLEDRSLERGDKILNLLNNLPQAIAT
EDLEDDDSGLALD
Download sequence
Identical sequences L8ASP1 Q55625
gi|383492134|ref|YP_005409810.1| 1148.sll0754 WP_010873366.1.11876 WP_010873366.1.1889 WP_010873366.1.18904 WP_010873366.1.33690 WP_010873366.1.35395 WP_010873366.1.47586 WP_010873366.1.99424 gi|383323081|ref|YP_005383934.1| gi|16331339|ref|NP_442067.1| gi|16331339|ref|NP_442067.1| gi|383326250|ref|YP_005387103.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]