SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331380|ref|NP_442108.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331380|ref|NP_442108.1|
Domain Number 1 Region: 1-188,311-438
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.37e-51
Family Glutathionylspermidine synthase ATP-binding domain-like 0.026
Further Details:      
 
Domain Number 2 Region: 214-324
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.16e-22
Family Glutathionylspermidine synthase substrate-binding domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331380|ref|NP_442108.1|
Sequence length 447
Comment hypothetical protein sll0023 [Synechocystis sp. PCC 6803]
Sequence
MQPIKISRRPRWRQHIQDNAYQADVLSDPAQKYWVEALPQPFAIQFSPQEETAIAIASEK
LWQMCVEFLDWFFDEDDDSAVDARLAQLKIRPEYWPALKKSWHRTDPVEDLSLATRFDLV
VTEDGQIKLIEINGETPLLGAETVYQWNWLVDYQRNHNQGAYALPANASQFNEYWERTAG
QWRRIYEEYDLLRTGISFLVDEQLEEDSEMAMQLIQILHDEVDENVYTQLVYLRGLEDER
GQLMQRGLGLDEDGYFIDHANERIPILWKMYDWSDLQNDMANAGCTEALAQRLAVGDAKV
IEPLWKQILSNKGTMALIWQQFKDSEYAEYLLPTYFESDISLEATRLLLEGLHVRKPLLG
MEGIGVSIELGAGAVEKRPTYGYGEEGFIIQEYIELPQAFDYHYMVGSWVIDDVAAGIIL
RGDTARITGRHCLIIPHIVAEEFLSIS
Download sequence
Identical sequences L8ARE2 Q55658
gi|16331380|ref|NP_442108.1| gi|383326290|ref|YP_005387143.1| 1148.sll0023 gi|383323121|ref|YP_005383974.1| gi|383492174|ref|YP_005409850.1| gi|16331380|ref|NP_442108.1| WP_010873406.1.11876 WP_010873406.1.1889 WP_010873406.1.18904 WP_010873406.1.33690 WP_010873406.1.35395 WP_010873406.1.47586 WP_010873406.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]