SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331388|ref|NP_442116.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331388|ref|NP_442116.1|
Domain Number 1 Region: 46-383
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 1.4e-94
Family MLTA-like 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331388|ref|NP_442116.1|
Sequence length 383
Comment membrane-bound lytic transglycosylase A [Synechocystis sp. PCC 6803]
Sequence
MIKQFFPLLALLLVFGFHGSGLRAQSRPLMPVTGANLTPTVGFDEQLWGNHCSAGDKQSL
LRAIDHSLSYLKTASAARAYQNYSVPGVTRERVTRSLQRFKTLLQQSPSPEALQTAVARE
FQFYQAIGNDGKGTVHFTGYFEPVYTASRQRTAEYRYPIYGLPNNFSRWSKPHPTRADLE
GMDGLGKSSQLQGREIAWFRNRLDAYLIQVQGSAKINWVGGGQSSVAFAGATDYPYVSLG
KETIQEGIFQPGEVTLPKLIDYFEQNPSELSRFIPRNNRLIFFKETSASTPAKGSIGVPV
TAERSIATDKFLMPPGAIAVLAAPIPDCQGQKVNVSRFVVDQDTGSAIKGPGRVDIFMGT
GQTPGDRAGLMSDDGQIYYLLLR
Download sequence
Identical sequences Q55666
gi|383323129|ref|YP_005383982.1| 1148.sll0016 NYSGXRC-10110f WP_010873414.1.11876 WP_010873414.1.1889 WP_010873414.1.18904 WP_010873414.1.33690 WP_010873414.1.35395 WP_010873414.1.47586 WP_010873414.1.99424 gi|16331388|ref|NP_442116.1| gi|383326298|ref|YP_005387151.1| gi|383492182|ref|YP_005409858.1| gi|16331388|ref|NP_442116.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]