SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331411|ref|NP_442139.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331411|ref|NP_442139.1|
Domain Number 1 Region: 392-414,444-782
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.41e-125
Family beta-Lactamase/D-ala carboxypeptidase 0.0000384
Further Details:      
 
Domain Number 2 Region: 225-437
Classification Level Classification E-value
Superfamily Lysozyme-like 9.56e-74
Family PBP transglycosylase domain-like 0.00000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331411|ref|NP_442139.1|
Sequence length 885
Comment penicillin-binding protein 1A [Synechocystis sp. PCC 6803]
Sequence
MFKSFSRKLKRSTVNFLHQLANTLEVEEEVKSSAIEEKTLPVAQVAQHLESEAQNSVDGD
DGLIFPGDGDAAELEPGYGRGREMVTAINIQNVQHHSSANGAAAAEQNKSNGNGSEPGAS
TVTAEQVTSVPLSSADNTLERGSRRRRRRKRGKHKQSAPKTPLALVTGLKNVGRSVSQLT
QQPRFWLVFGFGLGAGMGTSALAWGFYQLETMTQVAIADVVTYAPRGTMTIKAANGAILQ
EIGNVSHDKVTMGEIPPLVEQAFVASEDSRFREHRGIDLQGIMRASLSNVQSGGVMQGGS
TITQQLARLVFLTQDRTLARKLKEVRLAQKIETALPKDQILERYLNLIYLGSGAYGVADA
AHAYFSKTPEELTLGEAATLAGVVPAPSVYSPRQNLELATRRRNEVLNRMAEVGFITPAE
AQAAIAEPLVINPSPLKRFNREAEFFADYILDELRAKLPEEELQQGGLTVNTTLNQQWQE
EAQTVLSDAVKRYGRWQRFSEGAMVAMDPRTGAIKMMVGGKDYDASQFNRVTQAKRQPGS
TFKPILYGAAIASGISPNKSYLNVPIDIGGYQPANYGDRYTGGNMSLTDALTSSVNVVAV
RLLLDVGWNPVINLARQMGITSKLEPTYSLALGAWEMTPLEMTSAYGTFANKGTHVQPYA
IQNVVNAQGEVVYKAEHKQTQALDPESNAILTSMMRRVVTSGTGRPAQLGDRQVAGKTGT
SDEAKDLWFIGYIPQLVTGVWLGNDNSRPTNGASTTAAMVWGQFMRDATKGMPVQSFPAL
PKNLDQRKPSIKAEPIKRRVKTLAPPSSPETDGQNTTERPRRHRRTQTDAARPSNIQTAR
TSAPASAPSAPPRAVSAPAPVAAPAAAPADANAGLPAPPAARKSE
Download sequence
Identical sequences Q55683
gi|383326321|ref|YP_005387174.1| gi|16331411|ref|NP_442139.1| gi|383492205|ref|YP_005409881.1| gi|16331411|ref|NP_442139.1| WP_010873436.1.11876 WP_010873436.1.1889 WP_010873436.1.18904 WP_010873436.1.33690 WP_010873436.1.35395 WP_010873436.1.47586 WP_010873436.1.99424 gi|383323152|ref|YP_005384005.1| 1148.sll0002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]