SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331432|ref|NP_442160.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331432|ref|NP_442160.1|
Domain Number 1 Region: 168-412
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.51e-72
Family Extended AAA-ATPase domain 0.0000000305
Further Details:      
 
Domain Number 2 Region: 422-619
Classification Level Classification E-value
Superfamily FtsH protease domain-like 4.58e-70
Family FtsH protease domain-like 0.00000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331432|ref|NP_442160.1|
Sequence length 627
Comment cell division protein FtsH [Synechocystis sp. PCC 6803]
Sequence
MKFSWRTALLWSLPLLVVGFFFWQGSFGGADANLGSNTANTRMTYGRFLEYVDAGRITSV
DLYENGRTAIVQVSDPEVDRTLRSRVDLPTNAPELIARLRDSNIRLDSHPVRNNGMVWGF
VGNLIFPVLLIASLFFLFRRSSNMPGGPGQAMNFGKSKARFQMDAKTGVMFDDVAGIDEA
KEELQEVVTFLKQPERFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSE
FVEMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGNDEREQTLNQLLT
EMDGFEGNTGIIIIAATNRPDVLDSALMRPGRFDRQVMVDAPDYSGRKEILEVHARNKKL
APEVSIDSIARRTPGFSGADLANLLNEAAILTARRRKSAITLLEIDDAVDRVVAGMEGTP
LVDSKSKRLIAYHEVGHAIVGTLLKDHDPVQKVTLIPRGQAQGLTWFTPNEEQGLTTKAQ
LMARIAGAMGGRAAEEEVFGDDEVTTGAGGDLQQVTEMARQMVTRFGMSNLGPISLESSG
GEVFLGGGLMNRSEYSEEVATRIDAQVRQLAEQGHQMARKIVQEQREVVDRLVDLLIEKE
TIDGEEFRQIVAEYAEVPVKEQLIPQL
Download sequence
Identical sequences L8AR71 Q55700
gi|16331432|ref|NP_442160.1| gi|383323174|ref|YP_005384027.1| 1148.slr0228 gi|383326343|ref|YP_005387196.1| WP_010873456.1.11876 WP_010873456.1.1889 WP_010873456.1.18904 WP_010873456.1.33690 WP_010873456.1.35395 WP_010873456.1.47586 WP_010873456.1.99424 gi|383492227|ref|YP_005409903.1| gi|16331432|ref|NP_442160.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]