SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331449|ref|NP_442177.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16331449|ref|NP_442177.1|
Domain Number - Region: 92-204,308-361
Classification Level Classification E-value
Superfamily ARM repeat 0.0276
Family Mo25 protein 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331449|ref|NP_442177.1|
Sequence length 419
Comment hypothetical protein sll0412 [Synechocystis sp. PCC 6803]
Sequence
MPLPLMMINYSLLLSLALPPIAGGIIGYFTNDLAIKMLFRPYKPLFLGPYQLPFTPGLIP
RNQERLAKRVSDTIMGSLLTPEELQRLARKLLQRERVEGALGWLLQLALKQIREDKQQKT
AQILANILRDLFSESLPRLLKALARQDNFLSDQINRIFDQILLEFRLSELQSRQFADWLL
GTVLPPDTIRLALVDFLSDRNIQVIDEGFREKTSGTYWVVANLFGVRNSLTRLRAFCLEE
KETANLRLKELLLSLEIRNRLKDWLQQLSLENLPVSTVRQLRRTTGEVVRTYIRERGEPL
LKDFGSSVDWDNVAVLIVNRLQSSTAVTGSLGLVSEELASILERYLEDDLEKIVKQIIPI
LAIDQVIINRINETPAAELETAVQAIVRSELQAIVNLGGVLGLIIGGLQTGFFLVSRGF
Download sequence
Identical sequences L8ASC6 Q55115
gi|383326359|ref|YP_005387213.1| SgR212 WP_010873473.1.11876 WP_010873473.1.1889 WP_010873473.1.18904 WP_010873473.1.33690 WP_010873473.1.35395 WP_010873473.1.47586 WP_010873473.1.99424 gi|383492243|ref|YP_005409920.1| 1148.sll0412 gi|16331449|ref|NP_442177.1| gi|383323190|ref|YP_005384044.1| gi|16331449|ref|NP_442177.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]