SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331470|ref|NP_442198.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331470|ref|NP_442198.1|
Domain Number 1 Region: 7-70
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000407
Family SinR domain-like 0.018
Further Details:      
 
Weak hits

Sequence:  gi|16331470|ref|NP_442198.1|
Domain Number - Region: 181-223
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 0.00968
Family Head domain of nucleotide exchange factor GrpE 0.01
Further Details:      
 
Domain Number - Region: 87-122
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0112
Family Mitotic arrest deficient-like 1, Mad1 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331470|ref|NP_442198.1|
Sequence length 227
Comment hypothetical protein sll0072 [Synechocystis sp. PCC 6803]
Sequence
MTNIPYRENLQRLCEQAGYASLSKLSETADISTWYLYRLERGLIAQIPLGVMVKLAIALG
LTLEELWQELGGGNELGKIEQDQAVIEENQQLQQTIKALQGEYTRLQRQLTYQSQQLESQ
WQQKALEILEPWLLQWPTAAAAAQQNPQWPAQKLLPLTKPIATLLQQWQVEVIATVGEMV
PYDPQYHEFIGPGPRPDVGTMVMVRYVGYRRSEALLYRAKVGYAGDA
Download sequence
Identical sequences L8ANV7 Q55133
gi|16331470|ref|NP_442198.1| gi|16331470|ref|NP_442198.1| 1148.sll0072 gi|383323211|ref|YP_005384065.1| WP_010873494.1.11876 WP_010873494.1.1889 WP_010873494.1.18904 WP_010873494.1.33690 WP_010873494.1.35395 WP_010873494.1.47586 WP_010873494.1.99424 gi|383326380|ref|YP_005387234.1| gi|383492264|ref|YP_005409941.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]