SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331475|ref|NP_442203.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331475|ref|NP_442203.1|
Domain Number 1 Region: 858-1037
Classification Level Classification E-value
Superfamily ARM repeat 2.3e-16
Family Clathrin adaptor core protein 0.061
Further Details:      
 
Domain Number 2 Region: 575-713,750-845
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000133
Family PBS lyase HEAT-like repeat 0.032
Further Details:      
 
Domain Number 3 Region: 125-301
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000642
Family G proteins 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331475|ref|NP_442203.1|
Sequence length 1239
Comment hypothetical protein sll0068 [Synechocystis sp. PCC 6803]
Sequence
MPEGIYSACDPKFLAIAPNSCFLPTLLATTMVHSSSLSGTANNHHGQENNQESSPNVPDW
ATVCQQLLYRALPCTSVQTQPEWVVKKAGRIPRSLKVIASGSTGGHNAPASYGPLEFLDS
LLTPIAEGGEKSRYLAIVGEAGSGKTIFLQHFAQGLWQRHQEGQAHCLPIWLNPSRFKHR
SIKDYLFGPWLQEAMALEEEIPPATWRDSLLLGLQTGQFWLVLDGIDYTFTDPSQMSGAQ
GSLTWLKDSLAEVPTTPVLLSCRPDTRRNDPRGLAGFTRYQIEPLVYPDNVEIAIEDYFS
ADRPGQPENPGKPNALANALKEALANPSVRYLRPYLLRPRRLMLCCRFWADQPRDFPVSS
GALYNKLVKAFYLWQSEWAPTKPGQQDELAQLLGQLAKQMLGENRADHRPLAPVEVEKIF
GKDSPLLRSALQLGWLIPKTAVRKGVWERGYGFADDTFRDYFAALAIADWHFFLDIYRHQ
YRIFDPEWQRVLAFWWGREDISLVNKQAFLQAMLEFDDRCSPENFYGLRALECAALALRE
CPDLAQADEIVARLLAQGLPPMAGNGGQQKWVTALLTETHRAPVLQALLKILQTTEDDRI
YGQCCQWLGQWGQGFPQAIEVLEQQLALHEQSSLRFAIASALILIDPNSSPGVATFLAAL
RPGQKDYSLALQTLAHCAVGNLPVIKALLDFLSPKLSVLHHRQVLQCLEVVGKNHSLVIA
GLLQKLRLYPPGAFLCQTAESLEKIDPGNPTALVVLQRHIQADQPLPLRKQAIYSLGEVE
VPSPTVVAGLADLLMAEEDVFVRWLIVSSLAKIGQGDPSAIATLTTLVEKAVAQPRTEEG
DWLLNETIQALLKVDPQNVGILSSLVYLLENTETSEHLQTWAEILGRIDPGNPIAINTLL
RLLRNKEDPYGQRQAAASLATIDPGNLSALMALINLLQNGDNESIRLAAAQDLALVGKNN
PAVLAALIRVVGTDTEAEILRGVVKTLAQIGSNNREVTQALVGLLLENPEDRVRQDGTQA
LIKIVPRKLLPTVVYQLRELCARPQGENLADHWQIFWYCARQMTYADFYQAWHQTPLAVS
GTSIPGKSSKQRSFFRYSLAQTLQGESDPLNGCRIIWIDTSQFLNLDNPSVDIYDQMLDQ
DCPEFDGAIPDNLSKLRFYWHQLQRKQGHPLLLLFEQLSPSPLDLEQLWQQLGTFHGPIA
ILGVTPAPKTVVLPYFQLRESQTTAADIVAWLQNCLTSP
Download sequence
Identical sequences Q55138
gi|383323216|ref|YP_005384070.1| gi|16331475|ref|NP_442203.1| 1148.sll0068 gi|383326385|ref|YP_005387239.1| gi|16331475|ref|NP_442203.1| gi|383492269|ref|YP_005409946.1| WP_010873499.1.11876 WP_010873499.1.1889 WP_010873499.1.18904 WP_010873499.1.33690 WP_010873499.1.35395 WP_010873499.1.47586 WP_010873499.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]