SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331494|ref|NP_442222.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331494|ref|NP_442222.1|
Domain Number 1 Region: 219-629
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.53e-92
Family RecA protein-like (ATPase-domain) 0.0000000548
Further Details:      
 
Domain Number 2 Region: 18-176
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000000000000615
Family GSPII protein E N-terminal domain-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331494|ref|NP_442222.1|
Sequence length 672
Comment general secretion pathway protein E [Synechocystis sp. PCC 6803]
Sequence
MTSSSSSKKSRAVALRNYFSPFGNKLVAGGHVDAEQLRQALVQVKKTGRSLPEELKAVTG
RELSPELLRQYKKNQLFELKVLYGVDSVDPEVAPIATQQMAELIGRFFPLDTCRRFKFLP
LAQQEGDPPSVLVAMVDPDNLAAQDELNRILRVKGFELRRLVVTQDDFNQLLEQYYAIRE
EWEAAQEKRDQERALDKLNDLTDIVGSIDMNLGEDKEDVDNALDSNDANQAPVINLVNKI
LAKALQEGTSDIHVEPQEETLRIRFRKDGVLNQAFDPLPRKITPAVVARFKIMADMDIAE
RRSPQDGKIRRIYQGRKVDFRVNTLPSRYGEKVCLRILDNSATQLGLDFLITNPETLQTV
RELAARPYGLMLVTGPTGSGKSTTLYSVLAERNSPEVNINTAEDPIEYALPGITQVQVIR
EKGMDFSNILRAFMRQDPDVILVGETRDKETAKTAIEAALTGHLVLTTLHTNDAAGAIAR
LDEMGVEPFMVSGSLLGVLAQRLMRKVCTECRIAYHPSKEELSRFGLSASGDEVVTFYKA
NSLSPDEIHLARQKGNLCQKCSGSGYKGRVGVYEVMRNSERIAELINQGATTDRIKDCAV
EEGMITLLAYSLNLVQEGYTTLEEVERVTFTDTGLESEMRAKRKSALTCRTCAAELQQEW
LDCPYCMTSRFS
Download sequence
Identical sequences L8ANS9 Q55155
gi|383492289|ref|YP_005409966.1| gi|16331494|ref|NP_442222.1| gi|383323236|ref|YP_005384090.1| gi|383326405|ref|YP_005387259.1| WP_010873519.1.11876 WP_010873519.1.1889 WP_010873519.1.18904 WP_010873519.1.33690 WP_010873519.1.35395 WP_010873519.1.47586 WP_010873519.1.99424 1148.slr0063 gi|16331494|ref|NP_442222.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]