SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331499|ref|NP_442227.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331499|ref|NP_442227.1|
Domain Number 1 Region: 98-347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.03e-58
Family Nitrogenase iron protein-like 0.001
Further Details:      
 
Domain Number 2 Region: 1-89
Classification Level Classification E-value
Superfamily Fe-S cluster assembly (FSCA) domain-like 5.23e-26
Family PaaD-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331499|ref|NP_442227.1|
Sequence length 353
Comment ATPase [Synechocystis sp. PCC 6803]
Sequence
MLTTDAVLTVLRPVQDPELQKSLVELNMIRDVAIAGGTVSFTLVLTTPACPLREFIVEDC
EKAVKTLPGVEKVEVKVTAETPQQKSLPDRQSVGQVKNIIAISSGKGGVGKSTVAVNVAV
ALAQTGAAVGLLDADIYGPNAPTMLGLSGAAVQVQNSPQGEVLEPVFNHGIKMVSMGFLI
DPDQPVIWRGPMLNGIIRQFLYQVNWGALDYLIVDMPPGTGDAQLTLTQSVPMAGAVIVT
TPQTVSLLDARRGLKMFQQMGVNVLGIVENMSYFIPPDLPDRQYDLFGSGGGEKASKELN
VPLLGCVPLEIGLREGGDKGVPIVVSQPESASAKALTAIAKQIAGKVSMAALV
Download sequence
Identical sequences L8ANS3 P53383
1148.slr0067 gi|383326410|ref|YP_005387264.1| gi|383492294|ref|YP_005409971.1| SgR29 gi|16331499|ref|NP_442227.1| gi|16331499|ref|NP_442227.1| WP_010873524.1.11876 WP_010873524.1.1889 WP_010873524.1.18904 WP_010873524.1.33690 WP_010873524.1.35395 WP_010873524.1.47586 WP_010873524.1.99424 gi|383323241|ref|YP_005384095.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]