SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331503|ref|NP_442231.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331503|ref|NP_442231.1|
Domain Number 1 Region: 2-205
Classification Level Classification E-value
Superfamily Formyltransferase 3.53e-63
Family Formyltransferase 0.00000231
Further Details:      
 
Domain Number 2 Region: 207-321
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.33e-20
Family Post formyltransferase domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331503|ref|NP_442231.1|
Sequence length 330
Comment methionyl-tRNA formyltransferase [Synechocystis sp. PCC 6803]
Sequence
MMKTVFFGTPDFAVPTLEALLGHPDIDVLAVVSQPDRRRGRGSKLIPSPVKEVAVQAGIP
VWQPERVKRCQETLAKLKNCQADFFVVVAYGQLLSPEILVMPRLGCVNVHGSLLPKYRGA
APLQWAIANGETETGVTTMLMDEGMDTGAMLLKTTTPIGLMDNLTAIGDRLARSGAELLV
QTLKDLDAGQLQPIPQTETEATYAPLLKKGDFVINWHRSALEIHNQVRGFAPACHTAWGE
QILKIISTVPLGAEFFPLLPEKYQDLATAYLNYSLEAGEPGNIIGTIKNWGPVLETGNGH
LLLEQVQPPGKKPQSGWDFINGNRSTISFA
Download sequence
Identical sequences Q55163
gi|383492298|ref|YP_005409975.1| WP_010873528.1.11876 WP_010873528.1.1889 WP_010873528.1.18904 WP_010873528.1.33690 WP_010873528.1.35395 WP_010873528.1.47586 WP_010873528.1.99424 1148.slr0070 gi|16331503|ref|NP_442231.1| gi|383326414|ref|YP_005387268.1| gi|383323245|ref|YP_005384099.1| NYSGRC-FDAO-BAA10301 gi|16331503|ref|NP_442231.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]