SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331509|ref|NP_442237.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331509|ref|NP_442237.1|
Domain Number 1 Region: 136-319
Classification Level Classification E-value
Superfamily GAF domain-like 2.45e-59
Family GAF domain 0.00000000617
Further Details:      
 
Domain Number 2 Region: 327-514
Classification Level Classification E-value
Superfamily GAF domain-like 7.36e-57
Family Phytochrome-specific domain 0.00000000579
Further Details:      
 
Domain Number 3 Region: 585-746
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.01e-40
Family Histidine kinase 0.00063
Further Details:      
 
Domain Number 4 Region: 6-128
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.81e-32
Family BphP N-terminal domain-like 0.000000634
Further Details:      
 
Domain Number 5 Region: 512-595
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 7.26e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331509|ref|NP_442237.1|
Sequence length 748
Comment phytochrome [Synechocystis sp. PCC 6803]
Sequence
MATTVQLSDQSLRQLETLAIHTAHLIQPHGLVVVLQEPDLTISQISANCTGILGRSPEDL
LGRTLGEVFDSFQIDPIQSRLTAGQISSLNPSKLWARVMGDDFVIFDGVFHRNSDGLLVC
ELEPAYTSDNLPFLGFYHMANAALNRLRQQANLRDFYDVIVEEVRRMTGFDRVMLYRFDE
NNHGDVIAEDKRDDMEPYLGLHYPESDIPQPARRLFIHNPIRVIPDVYGVAVPLTPAVNP
STNRAVDLTESILRSAYHCHLTYLKNMGVGASLTISLIKDGHLWGLIACHHQTPKVIPFE
LRKACEFFGRVVFSNISAQEDTETFDYRVQLAEHEAVLLDKMTTAADFVEGLTNHPDRLL
GLTGSQGAAICFGEKLILVGETPDEKAVQYLLQWLENREVQDVFFTSSLSQIYPDAVNFK
SVASGLLAIPIARHNFLLWFRPEVLQTVNWGGDPNHAYEATQEDGKIELHPRQSFDLWKE
IVRLQSLPWQSVEIQSALALKKAIVNLILRQAEELAQLARNLERSNADLKKFAYIASHDL
QEPLNQVSNYVQLLEMRYSEALDEDAKDFIDFAVTGVSLMQTLIDDILTYAKVDTQYAQL
TFTDVQEVVDKALANLKQRIEESGAEIEVGSMPAVMADQIQLMQVFQNLIANGIKFAGDK
SPKIKIWGDRQEDAWVFAVQDNGIGIDPQFFERIFVIFQRLHTRDEYKGTGMGLAICKKI
IEGHQGQIWLESNPGEGSTFYFSIPIGN
Download sequence
Identical sequences L8ANQ9 Q55168
gi|16331509|ref|NP_442237.1| WP_010873534.1.11876 WP_010873534.1.1889 WP_010873534.1.18904 WP_010873534.1.33690 WP_010873534.1.35395 WP_010873534.1.47586 WP_010873534.1.99424 gi|383492304|ref|YP_005409981.1| gi|16331509|ref|NP_442237.1| NYSGRC-FDAO-BAA10307 1148.slr0473 gi|383323251|ref|YP_005384105.1| gi|383326420|ref|YP_005387274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]