SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331514|ref|NP_442242.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331514|ref|NP_442242.1|
Domain Number 1 Region: 32-214
Classification Level Classification E-value
Superfamily Formyltransferase 1.24e-59
Family Formyltransferase 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331514|ref|NP_442242.1|
Sequence length 217
Comment phosphoribosylglycinamide formyltransferase [Synechocystis sp. PCC 6803]
Sequence
MSAMSDLSNNLSFISPPVALGNIPQPRCLSLGIMASGSGSNFEAIAKAIKEGKLNAVVKL
VIYNNPNAGVRKRAMDHGVPHRLLNHRDYDSREDLDQDIVEHFRQAGVEWVIMAGWMRIV
TPVLLDAFSRRVLNIHPSLLPSFRGVRAVEQALAAGVKVSGCTVHYAEATVDSGPIVAQA
VVPILADDTGETLHQRIQVQEHRLFPLAIALAAQQSP
Download sequence
Identical sequences L8ANQ3 Q55172
gi|16331514|ref|NP_442242.1| NYSGRC-FDAO-BAA10312 gi|16331514|ref|NP_442242.1| gi|383492309|ref|YP_005409986.1| 1148.slr0477 gi|383326425|ref|YP_005387279.1| gi|383323256|ref|YP_005384110.1| WP_010873539.1.11876 WP_010873539.1.1889 WP_010873539.1.18904 WP_010873539.1.33690 WP_010873539.1.35395 WP_010873539.1.47586 WP_010873539.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]