SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331520|ref|NP_442248.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331520|ref|NP_442248.1|
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000011
Family PYP-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331520|ref|NP_442248.1|
Sequence length 163
Comment hypothetical protein slr0487 [Synechocystis sp. PCC 6803]
Sequence
MEFKNFFDALPLGVFVVDAQGRPVYANLAAIELLGKGLWPEAAIDRLNDIYQAYQIGTNQ
LYPLTEQPLLRALQGESHQVDDMEIRQGGQIIPLEVTGTPIFDQQGQLQYAMVVLRDLRD
RQRRNERQIALQQDLLRRNQGLVQENATLKRKLAMLEARLEAS
Download sequence
Identical sequences L8AS40 Q55178
gi|383492315|ref|YP_005409992.1| gi|16331520|ref|NP_442248.1| 1148.slr0487 gi|383323262|ref|YP_005384116.1| WP_010873545.1.11876 WP_010873545.1.1889 WP_010873545.1.18904 WP_010873545.1.33690 WP_010873545.1.35395 WP_010873545.1.47586 WP_010873545.1.99424 gi|16331520|ref|NP_442248.1| gi|383326431|ref|YP_005387285.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]