SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331549|ref|NP_442277.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331549|ref|NP_442277.1|
Domain Number 1 Region: 2-231,352-399
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.53e-79
Family Tandem AAA-ATPase domain 0.000000112
Further Details:      
 
Domain Number 2 Region: 713-930
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 3.27e-71
Family Helical scaffold and wing domains of SecA 0.0000111
Further Details:      
 
Domain Number 3 Region: 401-509,611-711
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.94e-52
Family Tandem AAA-ATPase domain 0.00000979
Further Details:      
 
Domain Number 4 Region: 230-352
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 3.92e-45
Family Pre-protein crosslinking domain of SecA 0.0000342
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331549|ref|NP_442277.1|
Sequence length 932
Comment preprotein translocase subunit SecA [Synechocystis sp. PCC 6803]
Sequence
MLKALFGDPNTRKLKKFQPYVAEVNLYEEDIEKLSDDELKYKTVEFREALDKARSDAETE
EILDEILPEAFAVVREAGKRVLGMRHFDVQLLGGIILHKGQIAEMKTGEGKTLVATLPSY
LNGLTGKGVHVVTVNDYLARRDAEWMGQIHRFLGLTVGLVQSGMNPEERKKNYACDITYT
TNSELGFDYLRDNMSTAMIEVVQRPFNFCIIDEVDSILIDEARTPLIISGQVERPTEKYL
QASDIAAQLEPEIHYEVDEKQRNVLMTDEGFEKAEQLLQTTDLFDKNDPWAHYIFNAIKA
KELFLKDVNYIVRNGEVVIVDEFTGRIMVGRRWSDGLHQAIEAKERVEIQKESQTLATIT
YQNFFLLYPKLSGMTGTAKTEETELEKVYNLQVTITPTNRPSSRQDWPDVVYKNEEAKWK
AVALECEELHQQGRPILVGTTSVEKSEVISRLLQSSGIHHNLLNARPENVERESEIVAQA
GRKGAVTIATNMAGRGTDIILGGNSDYMARLKVREYLMPKIVRPEDDELGAGVTGWVSGR
EKPQGFGNQNGKKKVKTWQVSPDIYPTTISQETEDLLKKAVKFAVDQYGLQSLTELEAED
KLAIASEKGPTDDPVILKLREVYNQIRREYEVLTSAEHKEVVELGGLHVIGTERHESRRV
DNQLRGRAGRQGDPGSTRFFLSLEDNLLRIFGGDRVAGLMNMFRVEEDMPIESKMLTGSL
EGAQKKVETYYYDIRKQVFEYDEVMNNQRKAIYAERRRVLEGLDLKEQVLVYAEKTMDEI
VDAYVNPELPPEEWDVENMLDKAKQFVYLLEDLTVEDLGDMTVWEMKTFFHEEVRKAYDL
KETQVDKVRPGLMREAERYFILQQIDNLWREHLQSMEALRESIGLRGYGQKDPLIEYKQE
GYEMFLEMMIDIRRNVVYSLFQFQPQQQPQAV
Download sequence
Identical sequences L8AQ01 Q55709
1148.sll0616 WP_010873574.1.11876 WP_010873574.1.1889 WP_010873574.1.18904 WP_010873574.1.33690 WP_010873574.1.35395 WP_010873574.1.47586 WP_010873574.1.99424 gi|383326460|ref|YP_005387314.1| gi|383492344|ref|YP_005410021.1| gi|383323291|ref|YP_005384145.1| gi|16331549|ref|NP_442277.1| gi|16331549|ref|NP_442277.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]