SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331560|ref|NP_442288.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331560|ref|NP_442288.1|
Domain Number 1 Region: 187-285
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 1.57e-30
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 35-118
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 2.62e-17
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00082
Further Details:      
 
Domain Number 3 Region: 120-184
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 1.08e-16
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331560|ref|NP_442288.1|
Sequence length 296
Comment hypothetical protein slr0639 [Synechocystis sp. PCC 6803]
Sequence
MVNLLFLFFIMSFFPNNIFDYDQQAITDLLITASLKILFALAILLIGFWLSKRLQKLIIR
ALRKSNLEPTFISFAGNISYYLLLVVFFVLCLAQLGIQTSSLVALLGASTLAIGLALQGS
LANVAGGILLVLFNYFRVGERIEVAGIEGIVESIEILSTTICTYDNRLVTIPNKQIIENN
IINHVGKPERRIDLVIGVGYEEDIDHVRSSLQWVIDQNSEVCTEPAPTIALGELGDSSVN
FYVRPWVKSEDYFRLKLQLTEAIKRKLDEENISIPFPQRDVHLIQPETKELDIKAA
Download sequence
Identical sequences Q55717
WP_010873585.1.11876 WP_010873585.1.1889 WP_010873585.1.18904 WP_010873585.1.33690 WP_010873585.1.35395 WP_010873585.1.47586 WP_010873585.1.99424 gi|383323302|ref|YP_005384156.1| gi|383326471|ref|YP_005387325.1| 1148.slr0639 gi|16331560|ref|NP_442288.1| gi|16331560|ref|NP_442288.1| gi|383492355|ref|YP_005410032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]