SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331582|ref|NP_442310.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331582|ref|NP_442310.1|
Domain Number 1 Region: 30-492
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.7e-175
Family Type II DNA topoisomerase 0.000000000299
Further Details:      
 
Domain Number 2 Region: 503-712,744-858
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 1.57e-97
Family GyrA/ParC C-terminal domain-like 0.0000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331582|ref|NP_442310.1|
Sequence length 860
Comment DNA gyrase subunit A [Synechocystis sp. PCC 6803]
Sequence
MTDSPDRLIATDLRNEMSQSYLEYAMSVIVGRALPDARDGLKPVHRRILYAMYELGLTPD
RPFRKCARVVGEVLGKYHPHGDTAVYDALVRMAQDFSMREPLIDGHGNFGSVDNDPPAAM
RYTESRLRPLSTNSLLRDIEAETVDFIDNFDGSQQEPTVLPARIPQLLINGSSGIAVGMA
TNIPPHNLGEVIDGAIALIRNPEITEQELMQIIPGPDFPTGAQILGRSGIREAYLTGRGS
ITMRGVASIETMEHPGRPDRDAIIVTELPYQTNKAALIERIADLVNDKKIDGIADIRDES
DRDGMRIVIELKRDAYARVVLNNLYKQTPIQSNFGANLLALVNGTPEVLTIKKFLTVFWE
FRIETITRRTRYELRKAEERDHLLQGLLIALDNLDAVIRLIRGAADTASAKTELVEGFSL
SEVQADAILQMQLRRLTALEADKITAEHDELQTKIADFQDILARRERVNAIIEEELEQIK
AIHATPRRTVIVQEDGELIDTDLIANDQALILLTEQGYIKRMPASTFGTQNRATRGKAAA
KIKDDDGVEHFLSCCDHDKVLFFSDRGVVYSLNAYQIPIASRTARGVPIVQMLPIPKDEK
ITSLVSVSEFDDDTYFIMLTKQGYIKKTALSAFSNIRANGLIAISLVEGDQLRWVRLAKA
EDSVIIGSQKGMAIHFKADQDELRALGRATRGVKSMRLRSGDALISMDILPSQVVANIAV
GSEDEPDEDLGGDTDAILEESDNPGPWLLGVTMKGFGKRVPIGQFRLQHRAGLGVKAIRF
KSKDDQLVALHVVNADDELMIVTNRGIIIRQSVNDISPQSRSATGVRVQRLDADDAIAAV
ALVPPSGEEELAEMSESEES
Download sequence
Identical sequences L8APX4 Q55738
gi|383323324|ref|YP_005384178.1| 1148.slr0417 gi|16331582|ref|NP_442310.1| gi|16331582|ref|NP_442310.1| gi|383492377|ref|YP_005410054.1| gi|383326493|ref|YP_005387347.1| WP_010873607.1.11876 WP_010873607.1.1889 WP_010873607.1.18904 WP_010873607.1.33690 WP_010873607.1.35395 WP_010873607.1.47586 WP_010873607.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]