SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331599|ref|NP_442327.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331599|ref|NP_442327.1|
Domain Number 1 Region: 231-312
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0000000000000174
Family Pollen allergen PHL P 1 N-terminal domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331599|ref|NP_442327.1|
Sequence length 321
Comment rare lipoprotein A [Synechocystis sp. PCC 6803]
Sequence
MKGINVCRSIAGVIGTASLTTLVWGNCPSGLLALNAITQADAPTAVSENNSSLAPLESSV
TATSSTPAPAFQDTELISLVPHQGPENRLAVTLRVNQIPVVTFLGTATELAALSNDQVTD
TMERAQTVARRLDELSGAEFFDPSTIKVGLDATTRQLVVKSEDEILLTINKNTVLPEKKL
SAPETALQTANRLRRLLGGAEPIVALPAALQVARVNTFDAAATIKRIKGGIASWYGPGFH
GRRTANGERFNQNALTAAHRTLPFGTRVKVTNLRNGQSVVVRINDRGPFTGGRVIDLSAG
AARAIGIHSSGVGNVALDIVQ
Download sequence
Identical sequences Q55752
gi|383323341|ref|YP_005384195.1| WP_010873624.1.11876 WP_010873624.1.1889 WP_010873624.1.18904 WP_010873624.1.33690 WP_010873624.1.35395 WP_010873624.1.47586 WP_010873624.1.99424 gi|16331599|ref|NP_442327.1| gi|383326510|ref|YP_005387364.1| gi|383492394|ref|YP_005410071.1| 1148.slr0423 gi|16331599|ref|NP_442327.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]