SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331624|ref|NP_442352.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331624|ref|NP_442352.1|
Domain Number 1 Region: 39-130
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 8.11e-26
Family Pentapeptide repeats 0.0018
Further Details:      
 
Domain Number 2 Region: 103-199
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000483
Family Tetratricopeptide repeat (TPR) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331624|ref|NP_442352.1|
Sequence length 259
Comment hypothetical protein sll0183 [Synechocystis sp. PCC 6803]
Sequence
MKIRPFLVALGLTTFAGAAHGANFEDLTQLLSTKKCPLCDLRGAGLVMVNLTRADLTGAD
LSGANLSGADLTGANLSGANLTSASLNGANLSGANLNGAITDGTDFREAYFDRATFINTN
LETAYMQGAKAVPNTAGTPQLFYGWGLLETSKGNYQSALNHYDQALALDPEFAPGYLGRG
LTLLKIGNEASAKQNVEYAQLLFEENQDEVGVKTSEQFLEDLANMQEARRQGAGNPQLDA
IVRGVASMAFKYLLPLVGL
Download sequence
Identical sequences L8AR79 Q55773
gi|383326535|ref|YP_005387389.1| gi|383492419|ref|YP_005410096.1| 1148.sll0183 WP_010873649.1.11876 WP_010873649.1.1889 WP_010873649.1.18904 WP_010873649.1.33690 WP_010873649.1.35395 WP_010873649.1.47586 WP_010873649.1.99424 gi|383323366|ref|YP_005384220.1| gi|16331624|ref|NP_442352.1| SgR115 gi|16331624|ref|NP_442352.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]