SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331626|ref|NP_442354.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331626|ref|NP_442354.1|
Domain Number 1 Region: 446-639
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.04e-39
Family ABC transporter ATPase domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 117-428
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 3.53e-29
Family ABC transporter transmembrane region 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331626|ref|NP_442354.1|
Sequence length 661
Comment ABC transporter [Synechocystis sp. PCC 6803]
Sequence
MTQAQAKRFQFDRQLWHRFVETAQPYFYPVGQKQTRVFLGLILALMVVVVALTLFLSMGL
TLWATAIFPDFFAKSGEGLVDGVQGLINSPAPWIGLVALAMAGAVFISQRQKLQQRWLQW
LLLGVLLSLLFVVNGLNVILSFVFRFIDTALNGKDAEVFWQFLWIYGIVIVVAIPIIVAY
RYLRQKLGVLWRQWLTEHFLGRYFKGRSYYHLDSNSAYTLIDNPDQRITQDIQSFTGVTL
DFLLDILDSILTLISFTAILYTISQTLMWGLIGYAVFGTVVAIAIGTRLIRINYEQLRLE
ANFRYGLVRVRDNAESIAFYRGEGLERKQVTDRLLGAIRNFNLLIIWQALISLFQLGYNY
FTRLIPYIIIAPLYLAGDLDFGAIAQASLAFGMVLSALSLVTNQIQNITEFAASINRLGE
FYESLNGPSNELERPESTGFDHNVITTRIGATVALENVTLSPPNSSRILVRDLSLAVAPG
NHLLIMGPSGSGKSSLLRAIAGLWDSGQGTIERPELADLLFLPQRPYMILGTLREQLIYP
SAQSIADDDFLLETLNKVNLPDLAERFGGLDSLENWSSVLSLGEQQRIALARVFINQPRY
AILDEATSALDVNNEAELYHALTDLGTTFISVGHRPTLRNFHRQCLEVQAEGRWQISPIN
N
Download sequence
Identical sequences Q55774
gi|383323368|ref|YP_005384222.1| 1148.sll0182 gi|16331626|ref|NP_442354.1| gi|16331626|ref|NP_442354.1| WP_010873651.1.1889 WP_010873651.1.33690 WP_010873651.1.35395 WP_010873651.1.47586 WP_010873651.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]